Recombinant Human Insulin-Like Growth Factor I Protein (IGF1), Active
Beta LifeScience
SKU/CAT #: BLC-06006P
Recombinant Human Insulin-Like Growth Factor I Protein (IGF1), Active
Beta LifeScience
SKU/CAT #: BLC-06006P
Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Buy cytokines, chemokines, and growth factors for research online, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Insulin-Like Growth Factor I Protein (IGF1), Active is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE and HPLC. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Activity | Fully biologically active when compared to standard. The ED50 as determined by the stimulation of protein synthesis using rat L6 myoblasts is less than 10 ng/ml, corresponding to a specific activity of >1.0x10 5 IU/mg. |
| Uniprotkb | P05019 |
| Target Symbol | IGF1 |
| Synonyms | IBP1; IGF I; IGF IA; IGF IB; IGF-I; Igf1; IGF1_HUMAN; IGF1A; IGFI; IGFIA; Insulin like growth factor 1 (somatomedin C) ; Insulin like growth factor 1; Insulin like growth factor IA; Insulin like growth factor IB; Insulin-like growth factor I; Mechano growth factor; MGF; OTTHUMP00000195080; OTTHUMP00000195081; OTTHUMP00000195082; OTTHUMP00000195083; OTTHUMP00000195084; Somatomedia C; Somatomedin C; Somatomedin-C |
| Species | Homo sapiens (Human) |
| Expression System | E.Coli |
| Tag | Tag-Free |
| Complete Sequence | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Expression Range | MFPAMPLSSLFVN+49–118aa( E51R) |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 9.1 kDa |
| Research Area | Cancer |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, pH 7.2 |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation. Ca(2+)-dependent exocytosis of IGF1 is required for sensory perception of smell in the olfactory bulb. Acts as a ligand for IGF1R. Binds to the alpha subunit of IGF1R, leading to the activation of the intrinsic tyrosine kinase activity which autophosphorylates tyrosine residues in the beta subunit thus initiatiating a cascade of down-stream signaling events leading to activation of the PI3K-AKT/PKB and the Ras-MAPK pathways. Binds to integrins ITGAV:ITGB3 and ITGA6:ITGB4. Its binding to integrins and subsequent ternary complex formation with integrins and IGFR1 are essential for IGF1 signaling. Induces the phosphorylation and activation of IGFR1, MAPK3/ERK1, MAPK1/ERK2 and AKT1. |
| Subcellular Location | Secreted. |
| Protein Families | Insulin family |
| Database References | HGNC: 5464 OMIM: 147440 KEGG: hsa:3479 STRING: 9606.ENSP00000302665 UniGene: PMID: 29530981 |
