Recombinant Human Insulin-Like Growth Factor I (IGF1) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-02347P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IGF1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IGF1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IGF1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IGF1.

Recombinant Human Insulin-Like Growth Factor I (IGF1) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-02347P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Insulin-Like Growth Factor I (IGF1) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P05019
Target Symbol IGF1
Synonyms IBP1; IGF I; IGF IA; IGF IB; IGF-I; Igf1; IGF1_HUMAN; IGF1A; IGFI; IGFIA; Insulin like growth factor 1 (somatomedin C) ; Insulin like growth factor 1; Insulin like growth factor IA; Insulin like growth factor IB; Insulin-like growth factor I; Mechano growth factor; MGF; OTTHUMP00000195080; OTTHUMP00000195081; OTTHUMP00000195082; OTTHUMP00000195083; OTTHUMP00000195084; Somatomedia C; Somatomedin C; Somatomedin-C
Species Homo sapiens (Human)
Expression System E.coli
Tag N-GST
Target Protein Sequence GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Expression Range 49-118aa
Protein Length Full Length of Mature Protein
Mol. Weight 34.7kDa
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation. Ca(2+)-dependent exocytosis of IGF1 is required for sensory perception of smell in the olfactory bulb. Acts as a ligand for IGF1R. Binds to the alpha subunit of IGF1R, leading to the activation of the intrinsic tyrosine kinase activity which autophosphorylates tyrosine residues in the beta subunit thus initiatiating a cascade of down-stream signaling events leading to activation of the PI3K-AKT/PKB and the Ras-MAPK pathways. Binds to integrins ITGAV:ITGB3 and ITGA6:ITGB4. Its binding to integrins and subsequent ternary complex formation with integrins and IGFR1 are essential for IGF1 signaling. Induces the phosphorylation and activation of IGFR1, MAPK3/ERK1, MAPK1/ERK2 and AKT1.
Subcellular Location Secreted.
Protein Families Insulin family
Database References

HGNC: 5464

OMIM: 147440

KEGG: hsa:3479

STRING: 9606.ENSP00000302665

UniGene: PMID: 29530981

  • We found that elevated production of insulin-like growth factor 1 by polyploid ASCs rendered them more potent in tumor growth promotion in vitro. PMID: 30185144
  • No up-regulation of Wnt10A and IGF-1 mRNA was observed with 1,550-nm Er:Glass fractional laser treatment of androgenetic alopecia. PMID: 30096107
  • Significant negative or positive correlations were observed between IGF-1 concentrations and impairments on several EDI-2 subscales (drive for thinness, body dissatisfaction, interoceptive awareness, sense of ineffectiveness, interpersonal distrust, maturity fear) and on SCL-90 subitems (depression, hostility, obsessivity compulsivity, anxiety), suggesting a possible hormonal modulatory effect on specific aspects of eatin PMID: 29179911
  • This article reviews the tumor-specific molecular signatures of IGF-1-mediated epithelial-mesenchymal transition in breast, lung, and gastric cancers. [review] PMID: 30111747
  • Results provide evidence for the role of IGF-I: matrix protein interactions in cell growth, migration and melanoma progression through forming a complex with IGF binding proteins. PMID: 29330502
  • The molecular interactions of IGF1-IGF1R binding have been dissected. PMID: 29483580
  • genetic association and nutrigenomic studies in population of postmenopausal women in China: Data confirm that dietary acid load is associated with postmenopausal osteoporosis; an SNP in IGF1 (rs35767) is not associated with this relationship in the population studied. PMID: 30018240
  • Low IGF-I levels are associated with non-alcoholic fatty liver disease. PMID: 29395967
  • Low IGF1 expression is associated with retinopathy of prematurity. PMID: 29274846
  • Low IGF-I levels are associated with dry eye syndrome. PMID: 29452886
  • serum IGF-1 is associated with more muscle mass, higher bone mineral density, and better handgrip performance in both genders among community-dwelling middle aged and older adults in Taiwan PMID: 28351218
  • insulin-like growth factor 1 (IGF1) is a direct target of miR-1827. PMID: 28387248
  • Results found that the expression of IGF-1 was up-regulated in cumulus cells (CCs) of women with polycystic ovary syndrome (PCOS), which was inversely proportional to the expression level of miR-323. Also, IGF1 3'UTR is targeted by miR-323. PMID: 30300681
  • Study in hepatocellular carcinoma cell line elicited a new mechanism in which IGF-1 induced epithelial-mesenchymal transition through regulation of survivin and a downstream pathway. PMID: 29989646
  • in this study, the influence of IGF-1 and BMP-7 in different concentrations on the osteogenic differentiation of two human MSC-subtypes, isolated from reaming debris (RMSC) and iliac crest bone marrow (BMSC) has been assessed PMID: 29874864
  • AMH, IGF1 and leptin levels in follicular fluid have no relation to the fertility disorders caused by endometriosis or fallopian tube damage, though they are biomarkers for anovulatory fertility disorders. PMID: 29595066
  • pituitary growth hormone secretory capacity is not related to the IGF-1 levels PMID: 29098662
  • Peripheral totalIGF-1 and IGFBP-3 were associated with better performance in attention, visuospatial, and global cognitive domains, independent of the gait speed. PMID: 29547749
  • CA repeat polymorphism of the P1 promoter of the IGF1 gene was associated with strength predispositions in the homozygous and non-carriers groups. In the group who were heterozygous it was speed-strength aptitudes. PMID: 29543920
  • IGF1 levels in systemic lupus erythematosus patients decline with age at a similar rate as in healthy controls, are associated with positive metabolic effects and despite a moderating effect on B, NK and CD8+ cells, do not affect clinical disease activity or severity. PMID: 29385899
  • results indicate that IGF-1 gene polymorphisms play crucial roles in the histopathological progression of IgA Nephropathy in the Chinese Han population PMID: 29402846
  • Low IGF1 level is associated with steatosis in Pituitary Diseases. PMID: 29065431
  • They retained the main IGF-1R-related properties, but the hormones with His49 in IGF-1 and His48 in IGF-2 showed significantly higher affinities for IR-A and for IR-B, being the strongest IGF-1- and IGF-2-like binders of these receptors ever reported. PMID: 29608283
  • Mechanism of activation of SGK3 by IGF1 via the class 1 and class 3 phosphatidylinositol 3-kinases has been described. PMID: 29150437
  • IGF1 is associated with giant cell tumor of bone recurrence, which might serve as biomarker for giant cell tumor of bone recurrence PMID: 29651441
  • miR-19b is decreased in PCOS granulosa cells and miR-19b could be a granulosa cell proliferation inhibitor. miR-19b-mediated cell proliferation may act via directly targeting IGF-1. PMID: 29363717
  • Report deregulation of IGF1/IGFBP3 expression in breast cancer correlating with neoplasm staging and histologic grade. PMID: 30084561
  • Study observed that the IGF1 level was higher in human epithelial ovarian cancer (EOC) specimens than that in benign ovarian tumor specimens, and further analysis showed that a higher level of IGF1 was related to more advanced clinical stage and liver metastasis. Also, up-regulation of IGF1 by tumor-associated macrophages was shown to promote the proliferation and migration of EOC cell lines. PMID: 29251331
  • Overexpression of circHIPK3 increased the expression levels of IGF1 and knock-down reduced it. PMID: 28738961
  • 0001) only. Women who remained obese had increased cGP/IGF-1 ratio (p = 0.006) only. Increase in cGP/IGF-1 ratio is associated with obesity, but not hypertension. Changes of IGFBP-3 and/or cGP/IGF-1 ratio are associated with weight changes. The data suggest the role for cGP in obesity through autocrine regulation of IGF-1. PMID: 29921371
  • IGF-1 exerts antioxidant, anti-inflammatory and protective effects on the central nervous system. (Review) PMID: 29975480
  • Five single nucleotide polymorphisms (SNPs) of IGF-1 (rs6214, rs6218, rs35767, rs5742612, and rs5742714) were genotyped. DNA was extracted from peripheral blood and analyzed for SNP genotyping using PCR. rs6218 had a predictive role for the susceptibility and progression of osteosarcoma. The TC and CC genotypes of rs6218 indicated higher risk of osteosarcoma; associated with later stage and elevated risk of osteosarcoma PMID: 29232358
  • Bio informatics analysis of 982 lung cancer patients revealed that higher expression of TNF- alpha was associated with low risk of cancer progression while overexpression of IGF-1 was correlated with high risk. Collectively, these results reveal that the cytokines in the tumor microenvironment differentially modulate radiation therapy through a variety of signaling mechanisms. PMID: 27344406
  • Data suggest that lower IGF1 serum levels in aging are associated with lower handgrip strength and worse physical performance, but less recurrent falls, especially in men. This longitudinal study was conducted in the Netherlands. PMID: 29789408
  • Data suggest that R1353H point mutation constitutes an activating IGF1R variant that can result in extreme tall height with very low levels of serum IGFI; the mutation was observed in proband, his mother, and his 3 sons, however, only the proband (43 y/o) and eldest son (18 y/o) exhibit extreme tall height. [CASE REPORT] PMID: 29789409
  • IGF-1 treatment activated protein kinase B (AKT), which may inhibit autophagy via the AKT/mammalian target of rapamycin signaling pathway. Following inhibition of autophagy, drug resistant cells became sensitive to apoptosis induced by 5-fluorouracil. PMID: 29257307
  • Consistent with its enhanced expression in Laron syndrome, we provide evidence that TXNIP gene expression is negatively regulated by IGF1. PMID: 29339473
  • In elderly women with low-energy distal radius fractures, an association between IGF1 and lowest measures of bone mineral density was found, indicating that low IGF1 could be an indirect risk factor for fractures. PMID: 29178313
  • Expression of miR-30a-3p was significantly increased in the placentas of patients with preeclampsia. miR-30a-3p might be involved in the pathogenesis of preeclampsia by targeting IGF-1 and regulating the invasion and apoptosis of trophoblast cells. PMID: 29155142
  • results suggest that the different isoforms of the PI3K p110 subunit could be therapeutic targets for primary and metastatic colon cancer and that regulation of the NRD1/ADAM signaling pathway controls lipogenesis-mediated EMT in IGF-1-stimulated colon cancer cells. PMID: 28819788
  • Demonstrate the uptake of fluorescently labeled IGF-I into skeletal growth plates of live mice using multiphoton microscopy. PMID: 28798204
  • Study provides evidence that IGF-1/IGF-1R/hsa-let-7c axis can control the odonto/osteogenic differentiation of IGF-1-treated stem cells from apical papilla via the regulation of JNK and p38 MAPK signaling pathways. PMID: 27833148
  • Circulating sex steroids, prolactin, insulin-like growth factor (IGF) I, IGF-binding protein 3, and sex hormone-binding globulin (SHBG) were evaluated using backward elimination separately in women pre- and postmenopausal at blood collection. PMID: 28246273
  • association between serum IGFBP-1 and IGF-I levels with advanced fibrosis in non-alcoholic fatty liver disease patients PMID: 28927302
  • findings suggest that the IGF1 polymorphism rs5742714 may be a genetic predictor of susceptibility and prognosis of renal cell carcinoma. PMID: 27976731
  • The results of the study may help to inform future health interventions that utilize physical activity as a means to improve cognitive development in children, adolescents, and adults. Additionally, the study may assist in determining whether the putative effects occur via modification of plasma IGF-1 or BDNF concentrations. PMID: 29094050
  • Data show the differential expression of insulin like growth factor 1 (IGF-I) transcripts isoforms in bladder cancer, revealing a distinct suppression of IGF-IEc. PMID: 29848696
  • Peripheral blood aspirates overexpressing IGF-I via rAAV gene transfer undergo enhanced chondrogenic differentiation processes. PMID: 28467017
  • Human IGF-I propeptides and mutants were overexpressed in bovine articular chondrocytes. Secreted IGF-I propeptides stimulated articular chondrocyte biosynthetic activity as much as mature IGF-I. Of the 3 IGF-I propeptides, only proIGF-IA strongly bound to heparin, depending on N-glycosylation at Asn92 in the EA peptide. PMID: 29174671
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed