Recombinant Human Insulin Growth Factor-Like Family Member 1 (IGFL1) Protein (mFc)
Beta LifeScience
SKU/CAT #: BLC-06313P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Insulin Growth Factor-Like Family Member 1 (IGFL1) Protein (mFc)
Beta LifeScience
SKU/CAT #: BLC-06313P
Regular price
$49200
$492.00
Sale price$24000
$240.00Save $252
/
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Description | Recombinant Human Insulin Growth Factor-Like Family Member 1 (IGFL1) Protein (mFc) is produced by our Mammalian cell expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q6UW32 |
Target Symbol | IGFL1 |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | C-mFc |
Target Protein Sequence | APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS |
Expression Range | 25-110aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 39.2 kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Probable ligand of the IGFLR1 cell membrane receptor. |
Subcellular Location | Secreted. |
Protein Families | IGFL family |
Database References | |
Tissue Specificity | Detected in ovary and spinal cord. |
Gene Functions References
- Murine insulin growth factor-like (IGFL) and human IGFL1 proteins are induced in inflammatory skin conditions and bind to a novel tumor necrosis factor receptor family member, IGFLR1. PMID: 21454693
- The -1245 A-allele of the IGF1 promoter single nucleotide polymorphism is associated with a small head size and less brain sparing in small for gestational age born subjects PMID: 19147602