Recombinant Human Inhibin Beta C Chain (INHBC) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05612P
Greater than 95% as determined by SDS-PAGE.
Recombinant Human Inhibin Beta C Chain (INHBC) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05612P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Inhibin Beta C Chain (INHBC) Protein (His), Active is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Activity | The ED50 as determined by its ability to bind Human Activin RIIA in functional ELISA is less than 20 ug/ml. |
| Uniprotkb | P55103 |
| Target Symbol | INHBC |
| Synonyms | Activin beta C chain; Activin beta-C chain; IHBC; Inhbc; INHBC_HUMAN; Inhibin beta C chain; Inhibin, beta C |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His |
| Complete Sequence | GIDCQGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQCPLHIAGMPGIAASFHTAVLNLLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGCS |
| Expression Range | 237-352aa |
| Protein Length | partial |
| Mol. Weight | 14.83 kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm Filtered 4 mM HCl, 1 mM DTT |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Target Details
| Target Function | Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins. |
| Subcellular Location | Secreted. |
| Protein Families | TGF-beta family |
| Database References | HGNC: 6068 OMIM: 601233 KEGG: hsa:3626 STRING: 9606.ENSP00000308716 UniGene: PMID: 28116672 |
