Recombinant Human Inhibin Beta C Chain (INHBC) Protein (His), Active

Name: Recombinant Human Inhibin Beta C Chain (INHBC) Protein (His), Active
Brand: Beta LifeScience
SKU: BLC-05612P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Inhibin Beta C Chain (INHBC) Protein (His), Active is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 as determined by its ability to bind Human Activin RIIA in functional ELISA is less than 20 ug/ml.
Uniprotkb	P55103
Target Symbol	INHBC
Synonyms	Activin beta C chain; Activin beta-C chain; IHBC; Inhbc; INHBC_HUMAN; Inhibin beta C chain; Inhibin, beta C
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Complete Sequence	GIDCQGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQCPLHIAGMPGIAASFHTAVLNLLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGCS
Expression Range	237-352aa
Protein Length	partial
Mol. Weight	14.83 kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Lyophilized from a 0.2 μm Filtered 4 mM HCl, 1 mM DTT
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.

Target Details

Target Function	Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.
Subcellular Location	Secreted.
Protein Families	TGF-beta family
Database References	HGNC: 6068 OMIM: 601233 KEGG: hsa:3626 STRING: 9606.ENSP00000308716 UniGene: Hs.632722
Tissue Specificity	Expressed in benign prostatic hyperplasia.

Gene Functions References

Study shows an up-regulation of activin-C in aggressive prostate cancer only, suggesting that activin-C may play a role in the advanced stages of the disease. PMID: 28116672
The inhibin-betaC subunit is down-regulated, while inhibin-betaE is up-regulated by interferon-beta1a in Ishikawa carcinoma cell line. PMID: 23580013
Single Nucleotide Polymorphisms in INHBC gene is associated with brain metastasis in non-small-cell lung cancer PMID: 23284751
Activin-beta(C) is a regulator of activin-A. Activin-beta(C) is able to abolish cachexia and modulate reproductive tumour development in inhibin alpha-subunit knockout mice (alpha-KO) mice. PMID: 23180294
inhibin-betaC in normal and pathological placental tissue was demonstrated, although no differences in staining intensity could be observed. Functional role of novel inhibin-betaC subunit in normal and pathological human placenta is still quite unclear. PMID: 21117833
in endometrial cancer tissue demonstrated a significant association with hemangiosis although without any impact on the patients' survival PMID: 20683603
differential expression pattern of the betaC- and betaE-subunits in normal human endometrial tissue suggests that they function in endometrial maturation and blastocyst implantation. PMID: 21092084
the novel inhibin/activin-betaC subunit is expressed in human endometrioid adenocarcinomas and in the human endometrial carcinoma cell line HEC-1a PMID: 20952735
Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator) PMID: 20884846
Expression of the inhibin betaC and betaE subunits was demonstrated at the protein level and at the transcriptional level in normal human endometrial tissue and in the Ishikawa human endometrial carcinoma cell line. PMID: 20012305
Expression of inhibin beta C was detected in the human chorionic carcinoma cell lines JEG and BeWoand also in human placenta. PMID: 20458061
Role for the activin betaC-subunit as a regulatory mechanism to reduce activin A secretion via intracellular heterodimerization. PMID: 12960042
activin betaC subunit may exert its effect as inhibin C PMID: 16627954

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.