Recombinant Human Inhibin Beta B Chain Protein (INHBB) Protein (His)

Beta LifeScience SKU/CAT #: BLC-06600P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Inhibin Beta B Chain Protein (INHBB) Protein (His)

Beta LifeScience SKU/CAT #: BLC-06600P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Inhibin Beta B Chain Protein (INHBB) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P09529
Target Symbol INHBB
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His
Target Protein Sequence ECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECG
Expression Range 295-405aa
Protein Length Partial
Mol. Weight 16.5 kDa
Research Area Neuroscience
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.
Subcellular Location Secreted.
Protein Families TGF-beta family
Database References

HGNC: 6067

OMIM: 147390

KEGG: hsa:3625

STRING: 9606.ENSP00000295228

UniGene: PMID: 30151927

  • Presence of varicocele was associated with lower serum inhibin B. PMID: 27423503
  • Elevated activin B levels together with normal activin A levels identified patients with the diagnostic symptoms of chronic fatigue syndrome/myalgic encephalomyelitis. PMID: 28302133
  • Results identified Inhbb as one factor mediating the proliferative effect of Pdx-1 on islet cells. PMID: 27620967
  • Low activin B level is associated with tubal ectopic pregnancy. PMID: 26968108
  • Pregnant Han Chinese women carrying the rs7579169 CC genotype and G-G-C haplotype are significantly more likely to develop pre-eclampsia, especially late-onset and multiparous cases. PMID: 26313529
  • We report here an original observation that activin-B is upregulated in the human idiopathic pulmonary fibrosis lung. PMID: 25361680
  • reduction of RhoA signaling by Activin B together with persistent Rac1 activity is a prerequisite for inducing an invasive phenotype in clear cell renal cell carcinoma. PMID: 25343250
  • inhibin B and anti-Mullerian hormone serum concentrations did not provide an additional diagnostic tool for male infertility PMID: 25581422
  • inhibin B levels, but not FSH, are increased in primary hypothyroidism, which is consistent with a hypogonadotrophic hypogonadal state affecting the reproductive segment of the gonadotrophic axis PMID: 23692058
  • There are significant differences in serum inhibin B levels in patients with diminished ovarian reserve before and after supplementation with dehydroepiandrosterone (DHEA). PMID: 23664458
  • Inhibin B production was decreased following recombinant human chorionic gonadotropin administration in both control and polycystic ovary syndrome women. PMID: 24188875
  • Inhibin B was measured in plasma samples obtained from 34 healthy male subjects selected on criteria typical for a phase I clinical trial across a wide age range. PMID: 23349064
  • Data indicate that neither serum inhibin B nor follicle-stimulating hormone (FSH) is a suitable surrogate for determination of sperm concentration in a semen sample. PMID: 23423746
  • The signaling pathway responsible for hepcidin up-regulation in the inflammatory context is still not understood completely. Activin B has an unexpected but crucial role in the induction of hepcidin by inflammation. PMID: 22611157
  • A genome-wide association study for preeclampsia in unrelated Australian individuals of Caucasian ancestry was performed to genotype single nucleotide polymorphisms the Inhibin, beta B gene on 2q14.2, in preeclampsia and normal pregnancy controls. PMID: 22432041
  • inhibin-betaB subunit appears not to be a useful prognostic marker regarding endometrioid adenocarcinomas. PMID: 21938679
  • Compared with antimullerian hormone (AMH), stimulated serum inhBB is a more accurate predictor of ovarian response in patients undergoing in vitro fertilization. PMID: 21843890
  • Inhibin B constitutes a reliable marker of Sertoli cell function as well as spermatogenesis, while the clinical significance of anti-Mullerian hormone in men with varicocele remains to be elucidated. PMID: 21285453
  • High inhibin beta B is associated with cervical intraepithelial neoplasia grades 1 and 2 compared to cervix uteri. PMID: 21475087
  • Inhibin B and antimullerian hormone have a role in gonadal function after treatment for medulloblastoma or posterior fossa ependymoma during childhood PMID: 21168856
  • A variant in the fibrillin-3 gene is associated with TGF-beta and inhibin B levels in women with polycystic ovary syndrome. PMID: 20630504
  • The aim of the present study is to investigate the effect of obesity on testicular function by evaluating reproductive hormones, inhibinB, insulin-like 3(INSL3), and leptin, in obese and non-obese adolescents according to pubertal Tanner stages. PMID: 20713036
  • Serum inhibin-b levels decrease nonlinearly during the daytime, and are positively correlated with sperm counts, but the predictive power is best when inhibin-b is low. PMID: 20149358
  • Antral follicle size influences serum inhibin B and FSH levels and alters their expected relationship with the number of antral follicles on day 3 PMID: 19061996
  • Gonads in anorexia nervosa with weight gain have low level of activity. Inhibin B is early marker of gonadal activity, and with weight gain, awakening of the reproductive function is gradual. PMID: 15070953
  • Inhibin B pubertal surge is prominent signal of gonadal maturation in females as well as in males. Significantly higher in boys than in girls. Review. PMID: 15319819
  • The expression of inhibin betaB by Sertoli cells is dependent on the coexistence of spermatogenic activity within these seminiferous tubules and is low in patients with Sertoli cell only syndrome. PMID: 15551748
  • Ovulatory cycles were characterized by higher FSH and lower inhibin B leveels in hypergonadotropic hypogonadism or premature ovarian failure. PMID: 15562017
  • Regular increase of inhibin B(InhB) during puberty. In first phases of gonadal maturation, InhB and FSH correlate positively, while in mid-late stages relationship is inverse. In mid-puberty (G3-G4), serum InhB increases. PMID: 15757857
  • Exposure of the cells of Sertoli to excessive amounts of lead results in inappropriate inhibin B overproduction that may be involved in the impairment of spermatogenesis. PMID: 15910540
  • inhibin B may have a role in male fecundity PMID: 16024538
  • INHBB expression was high in human adipocytes, reduced by weight loss and adipose tissue INHBB mRNA levels correlated to metabolic risk factors. PMID: 16650820
  • A significant down-regulation of inhibin-beta (B) subunit in extravillous trophoblast cells in IUGR syncytiotrophoblast cells was demonstrated. PMID: 16670820
  • Preoperative serum inhibin B concentration could not reliably predict a response to varicocelectomy, but the increase in inhibin B levels after treatment might suggest an improvement in testicular function. PMID: 16728349
  • Follistatin was overexpressed while both activin subunits were downregulated in the majority of rat and human liver tumours PMID: 16935389
  • The present findings showed that treatment with vaginal estroprogestinic decreases serum inhibin A and inhibin B levels, the follicular diameter PMID: 16989826
  • Varicocele sclerotherapy improves inhibin B levels and seminal parameters. PMID: 17376219
  • it is not clear that inhibin B does not seem to play any role in the mechanism of action of laparoscopic ovarian diathermy [letter] PMID: 17525068
  • Granulosa cell production of inhibin B is reduced by pharmacologically induced increase in the intrafollicular androgen levels. PMID: 17628551
  • decreased levels of inhibin b are associated with hot flushes, aches, joint pain, stiffness and depressed mood in the stages of menopausal transition. PMID: 17666595
  • Activin B is a potent inducer of Pdx1 as well as Shh in differentiating embryonic stem cell derived embryoid bodies PMID: 17761145
  • Activin and estrogen crosstalk regulates transcription in human breast cancer cells. PMID: 17914098
  • Used monoclonal antibody to xenopus laevis Inhbb in ELISA for detection of human Inhbb. PMID: 17991484
  • Expression of the beta-B subunit is related to decidualization and can be detected in the circulation as activin B. PMID: 18381568
  • The degree of inhibin B increment during controlled ovarian stimulation provides a way for for predicting ovarian response to ovarian stimulation. PMID: 18555227
  • There was no significant association of (log)inhibin B profiles with age at final menstrual period. PMID: 18593767
  • Functional validation of activins and bone morphogenetic protein 11 as candidate novel muscle mass regulators. PMID: 18927237
  • Serum inhibin B and estradiol concentrations obtained shortly after Gn therapy may offer an accurate and early prediction of ovarian response. PMID: 19198021
  • Inhibin B is more potent than inhibin A in suppressing FSH in vitro and in vivo, and this difference in bioactivity is not explained by its affinity to betaglycan or activin type II receptors. PMID: 19589860
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed