Recombinant Human Immunoglobulin-Like Domain-Containing Receptor 2 (ILDR2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09584P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Immunoglobulin-Like Domain-Containing Receptor 2 (ILDR2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09584P
Collections: Cytokines, Others immune checkpoint proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Immunoglobulin-Like Domain-Containing Receptor 2 (ILDR2) Protein (His) is produced by our Yeast expression system. This is a extracellular protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q71H61 |
Target Symbol | ILDR2 |
Synonyms | ILDR2; C1orf32Immunoglobulin-like domain-containing receptor 2 |
Species | Homo sapiens (Human) |
Expression System | Yeast |
Tag | N-6His |
Target Protein Sequence | MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDSGLYYCIITTPDDLEGKNEDSVELLVLGRTGLLADLLPSFAVEIMPE |
Expression Range | 1-186aa |
Protein Length | Extracellular Domain |
Mol. Weight | 23.1kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | May be involved in lipid homeostasis and ER stress pathways. |
Subcellular Location | Endoplasmic reticulum membrane; Single-pass type I membrane protein. |
Protein Families | Immunoglobulin superfamily, LISCH7 family |
Database References |
Gene Functions References
- We demonstrated that ZNF70 interacts with ZFP64 and activates HES1 transcription by binding to the HES1 promoter. In addition, HES1 gene expression is increased in ILDR2-knockdown HepG2 cells, in which ZNF70 is translocated from the cytoplasm to the nucleus, suggesting that ZNF70 migration to the nucleus after dissociating from the ILDR2-ZNF70 complex activates HES1 transcription. These results support a novel link betwee PMID: 27353377
- Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) PMID: 20379614
- Observational study of gene-disease association. (HuGE Navigator) PMID: 19536175
- Observational study of gene-disease association. (HuGE Navigator) PMID: 19064610