Recombinant Human Immunity-Related Gtpase Family M Protein (IRGM) Protein (GST)

Name: Recombinant Human Immunity-Related Gtpase Family M Protein (IRGM) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-09171P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Immunity-Related Gtpase Family M Protein (IRGM) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	A1A4Y4
Target Symbol	IRGM
Synonyms	IFI1; Iigp3; Iipg3; Immunity related GTPase family M protein 1; Immunity related GTPase family, M; Immunity-related GTPase family M protein 1; Immunity-related GTPase family M protein; Interferon inducible protein 1; Interferon-inducible protein 1; Irgm; IRGM_HUMAN; IRGM1; LPS-stimulated RAW 264.7 macrophage protein 47 homolog; LRG 47; LRG-47; LRG-47-like protein; LRG47; MGC149263; MGC149264
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MEAMNVEKASADGNLPEVISNIKETLKIVSRTPVNITMAGDSGNGMSTFISALRNTGHEGKASPPTELVKATQRCASYFSSHFSNVVLWDLPGTGSATTTLENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCEY
Expression Range	1-181aa
Protein Length	Full Length
Mol. Weight	47.1kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Putative GTPase which is required for clearance of acute protozoan and bacterial infections. Functions in innate immune response probably through regulation of autophagy. May regulate proinflammatory cytokine production and prevent endotoxemia upon infection. May also play a role in macrophages adhesion and motility.
Subcellular Location	Golgi apparatus membrane. Cell membrane. Cytoplasmic vesicle, phagosome membrane. Cytoplasmic vesicle, autophagosome membrane. Cell projection, phagocytic cup.
Protein Families	TRAFAC class dynamin-like GTPase superfamily, IRG family
Database References	HGNC: 29597 OMIM: 608212 KEGG: hsa:345611 STRING: 9606.ENSP00000428220 UniGene: PMID: 29126912 The association of ATG16L1 to Crohn's disease in Iranian patients was confirmed while it was shown that the studied polymorphisms in IRGM was not associated with Crohn's disease. PMID: 29960072 Four haplotypes showed a frequency of > 1%, among which the haplotype C-T-A-T-G was significantly associated with chronic periodontitis PMID: 28983640 HCV triggers IRGM-mediated phosphorylation of the early autophagy initiator ULK1, thereby providing mechanistic insight into the role of IRGM in HCV-mediated autophagy. PMID: 28389568 Irgm1/IRGM participates in the polarization of M1 macrophages, is upregulated in human atheromata, and promotes development of atheroma in murine experimental atherosclerosis PMID: 27439214 The results confirmed that polymorphisms in NOD2 (Leu1007insC) and IRGM genes are associated with increased risk of Crohn's disease; whereas the ORMDL3 variant is associated with susceptibility to ulcerative colitis in the Lithuanian early-onset inflammatory bowel disease population. PMID: 27932194 IRGM rs10065172 was associated with decreased risk of tuberculosis in Asian populations, but not in African/Africa-Americans. rs4958842, rs4859843, and rs4859846, had a large protective effect in Asians, whereas rs72553867 was not associated with tuberculosis risk. PMID: 29068986 Polymorphisms of IRGM gene is associated with susceptibility to ankylosing spondylitis. PMID: 28031552 IRGM polymorphism differences between latent and active TB suggests that genetic differences in autophagy might partly affect host TB infection status. PMID: 26980495 IRGM functional polymorphisms and haplotypes in promoter were associated with the susceptibility to pulmonary tuberculosis in Chinese Hubei Han population. PMID: 26786655 In Korean children, IRGM rs1000113 and IRGM rs72553867 exhibited associations with early-onset Crohn Disease as risk loci and defense loci, respectively. PMID: 25944217 The study confirms IRGM rs13361189 and rs4958847 polymorphisms to be important for Crohn's disease susceptibility and phenotype modulation, in accordance with previous findings. PMID: 26066377 Expression of viral protein 2C enhanced IRGM promoter activation, thereby increasing IRGM expression and inducing autophagy. PMID: 25853521 these data reveal an Irgm1-dependent mechanism that promotes the tumorigenesis of melanoma via dual regulation of apoptosis and Bif-1-dependent autophagy PMID: 25619828 the IRGM(+313), an autophagy-related polymorphic locus, influences outcome in severely septic patients, with the possible involvement of autophagy in sepsis exacerbation PMID: 24626347 Results show association of IRGM gene SNPs with Crohn's disease in Indian patients and report a new mutation rs 9637876 in the IRGM gene associated with Crohn's disease. PMID: 25191865 Our findings suggest that expression of IRGM is dysregulated in gastric cancer and that the molecule may affect progression of the disease. PMID: 25707354 The IRGM rs13361189 polymorphism is promising as a biomarker for early diagnosis of Crohn's disease. However, the IRGM rs10065172 and rs4958847 polymorphisms may not be the major determinants of Crohn's disease risk. PMID: 25526194 Data indicate that immunity-related GTPase family M (IRGM) plays a direct role in organizing the core autophagy machinery to endow it with antimicrobial and anti-inflammatory functions. PMID: 25891078 RGM directly organizes the core autophagy machinery and links it with antimicrobial and anti-inflammatory functions. IRGM interacts with ULK1 and Beclin 1 promoting their co-assembly into autophagy initiation complexes. All three Crohn's disease risk factors, IRGM, NOD2 and ATG16L1, form a complex. NOD2 enhances K63-polyubiquitination of IRGM, promoting IRGM assembly with core autophagy regulators. PMID: 25891078 IRGM assembles core autophagy machinery (Beclin 1, Ulk1, ATG16L1) and connects it with innate immunity sensors (NOD2) through formation of protein complex assemblies. PMID: 25891078 This is the first study to identify a significant association between the IRGM single-nucleotide polymorphism (SNP) rs10065172 and susceptibility to active tuberculosis disease in an Asian population. PMID: 24595493 IRGM expression is upregulated in monocytes and monocyte-derived macrophages by Mycobacterium leprae PMID: 24469081 the presence of the IRGM1 rs13361189 variant allele was associated with a lower use of immunosuppressant therapy, high-lighting a possible role in the development of a milder phenotype. PMID: 24656308 a potential role of IRGM in the development of glioma probably by affecting IFN-gamma and IL-4. PMID: 24859836 Despite moderate effects on the modulation of proinflammatory cytokine production, genetic variation in the autophagy genes ATG16L1 and IRGM has a minor impact on the susceptibility to both mucosal and systemic Candida infections. PMID: 24713404 IRGM gene polymorphism is associated with the increased risk of leprosy by affecting inflammatory cytokines. PMID: 24264476 These results indicated that autophagy gene-IRGM polymorphisms appear to confer susceptibility to CD but not UC, especially in Europeans. PMID: 24232856 IRGM single nucleotide polymorphisms are associated with Crohn's disease. PMID: 22508677 In a Portuguese population, SNPs at three autophagy-related genes, ATG16L1, IRGM, and ITLN1, contribute to predict Crohn's ileal or ileocolonic disease, involvement of the upper digestive tract, and response to treatment. PMID: 22573572 IRGM is a susceptibility gene for Crohn's disease in the German population. PMID: 23365659 IRGM polymorphisms are associated with decreased susceptibility to pulmonary tuberculosis. PMID: 23049477 IRGM rs4958847 polymorphism influences susceptibility to gastric cancer, mainly for the intestinal type. PMID: 22713085 Variants in the genes ATG16L1 and IRGM affect autophagy and are associated with the development of Crohn's disease PMID: 22370477 IFN-gamma enhances Con A-induced autophagic flux and causes an IRGM1-dependent lysosome-mediated necrotic cell death in hepatocytes PMID: 22163006 Irgm3 relieves the ER stress response via a PI3K/Akt dependent mechanism, which contributes to host defence against coxsackievirus B3 infection. PMID: 21981022 Our work reveals an unexpected role of IRGM in virus-induced autophagy PMID: 22174682 Single-nucleotide polymorphism rs4958847 in the IRGM gene correlated very significantly with frequency of surgery in patients with ileocolonic Crohn's disease. PMID: 22228152 a critical "menage a trois" in risk susceptibility to Crohn disease combining IRGM allele, miRNA and xenophagy PMID: 21508684 this Crohn's Disease-related IRGM1 polymorphic allele is also associated with human susceptibility to tuberculosis disease among African Americans PMID: 21283700 Data show that an additive gene-gene interaction involving TLR4, PSMG1, TNFRSF6B and IRGM was identified with CD. PMID: 21079743 the unusual evolutionary history of the IRGM locus and the important role of the IRGM gene in autophagy and Crohn's disease in response to pathogenesis. PMID: 20737271 Data suggest that NKX2-3 and IRGM are susceptibility loci for inflammatory bowel disease in Eastern European patients. PMID: 21049557 In 1.7 kb IRGM promoter region, only -1208A/G polymorphism is associated with susceptibility to TB PMID: 20547146 IRGM demonstrated differential affinity for the mitochondrial lipid cardiolipin, translocated to mitochondria, affected mitochondrial fission and induced autophagy. PMID: 21102437 Observational study of gene-disease association. (HuGE Navigator) PMID: 19760754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator) PMID: 20886065 Observational study of gene-disease association. (HuGE Navigator) PMID: 20962850 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) PMID: 21049557 Observational study of gene-disease association. (HuGE Navigator) PMID: 21072187

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Immunity-Related Gtpase Family M Protein (IRGM) Protein (GST)

Recombinant Human Immunity-Related Gtpase Family M Protein (IRGM) Protein (GST)

Product Overview

Target Details

FAQs