Recombinant Human Immortalization Up-Regulated Protein (IMUP) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-10256P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Immortalization Up-Regulated Protein (IMUP) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-10256P
Collections: High-quality recombinant proteins, Other recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Immortalization Up-Regulated Protein (IMUP) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q9GZP8 |
Target Symbol | IMUP |
Synonyms | Chromosome 19 open reading frame 33; H2RSP; HAI 2 related small protein; HAI-2-related small protein; Hepatocyte growth factor activator inhibitor type 2 related small protein; Hepatocyte growth factor activator inhibitor type 2-related small protein; Immortalization up regulated protein; Immortalization up-regulated protein; Immortalization upregulated protein; IMUP 1; IMUP 2; IMUP; IMUP_HUMAN; MGC39135; MGC75180 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKASNFRGLGKGRRLTAAPPSSKDTTALPTPAAAPAIRTRM |
Expression Range | 1-85aa |
Protein Length | Full Length of Isoform 2 |
Mol. Weight | 35.5kDa |
Research Area | Epigenetics And Nuclear Signaling |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Subcellular Location | Nucleus. |
Database References |
Gene Functions References
- Hypoxia-induced down-regulation of XIAP mediates apoptosis in trophoblasts through interaction with increased IMUP-2; this mechanism underlies the pathogenesis of pre-eclampsia. PMID: 22886722
- results suggest that IMUP-2 expression is specifically elevated in preterm pre-eclampsia and under hypoxic conditions, and that IMUP-2 induces apoptosis of the trophoblast PMID: 20432246
- results showed the up-regulation of IMUP-1 and IMUP-2 in human ovarian epithelial tumors and suggested that the altered mRNA level of these molecules is possibly associated with ovarian tumorigenesis PMID: 14981917
- Nuclear translocation of H2RSP may be related to a signaling involved in the transition from cellular proliferation to differentiation in experimental murine colitis. PMID: 16189703
- Our findings suggest that the balance between hepsin and its inhibitor, HAI-2, may have prognostic value in RCC. PMID: 17309599
- These findings demonstrate the up-regulation of imup-1 and imup-2 in human endometrial carcinomas and indicate that these molecules play a role in endometrial carcinogenesis in both Korean and Japanese patients. PMID: 18507030
- H2RSP and H2RSP/HAI-2 chimeric peptides might function as a transcriptional regulatory peptide at the nucleus. PMID: 11606055