Recombinant Human IL37 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-0651P
Recombinant Human IL37 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-0651P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Host Species | Human |
| Accession | Q9NZH6 |
| Synonym | FIL1 FIL1 zeta FIL1(ZETA) FIL1Z IL 1 zeta IL 1F7 IL 1F7b (IL 1H4, IL 1H, IL 1RP1) IL 1H4 IL 1RP1 IL 1X IL 1X protein IL-1 zeta IL-1F7 IL-1H IL-1H4 IL-1RP1 IL-1X IL-37 IL1F7 IL1F7 (canonical product IL 1F7b) IL1F7_HUMAN IL1H4 IL1RP1 Interleukin 1 family member 7 interleukin 1 family, member 7 (zeta) Interleukin 1 homolog 4 Interleukin 1 related protein Interleukin 1 superfamily z Interleukin 1 zeta Interleukin 37 Interleukin-1 family member 7 Interleukin-1 homolog 4 Interleukin-1 zeta Interleukin-1-related protein Interleukin-23 |
| Description | Recombinant Human IL37 Protein (His tag) was expressed in E.coli. It is a Full length protein |
| Source | E.coli |
| AA Sequence | VHTSPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALA SSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAA QKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFEN RKHIEFSFQPVCKAEMSPSEVSD |
| Molecular Weight | 20 kDa including tags |
| Purity | >95% SDS-PAGE. |
| Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
| Formulation | Lyophilised |
| Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
| Reconstitution | See related COA |
| Unit Definition | For Research Use Only |
| Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
| Target Function | Suppressor of innate inflammatory and immune responses involved in curbing excessive inflammation. This function requires SMAD3. Suppresses, or reduces, proinflammatory cytokine production, including IL1A and IL6, as well as CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A and IL1RN, but spares anti-inflammatory cytokines. Inhibits dendritic cell activation. |
| Subcellular Location | Cytoplasm, cytosol. Nucleus. Secreted. |
| Protein Families | IL-1 family |
| Database References | HGNC: 15563 OMIM: 605510 KEGG: hsa:27178 STRING: 9606.ENSP00000263326 UniGene: PMID: 30206230 |
