Recombinant Human IL21 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-0527P
Recombinant Human IL21 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-0527P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q9HBE4-1 |
Synonym | CVID11 IL 21 IL-21 Il21 IL21_HUMAN Interleukin 21 Interleukin-21 interleukin-21 isoform Interleukin21 OTTHUMP00000164088 Za11 |
Description | Recombinant Human IL21 Protein (His tag) was expressed in Baculovirus infected insect cells. It is a Full length protein |
Source | Baculovirus infected insect cells |
AA Sequence | ADPEFMQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEW SAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCP SCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDSHHHHHH |
Molecular Weight | 17 kDa including tags |
Purity | >85% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |