Recombinant Human IL15RA Protein (Fc Tag Active)
Beta LifeScience
SKU/CAT #: BLA-0406P
Recombinant Human IL15RA Protein (Fc Tag Active)
Beta LifeScience
SKU/CAT #: BLA-0406P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q13261 |
Synonym | AA690181 CD215 I15RA_HUMAN IL 15R alpha IL-15 receptor subunit alpha IL-15R-alpha IL-15RA Il15ra Interleukin 15 receptor alpha Interleukin 15 receptor subunit alpha MGC104179 sIL-15 receptor subunit alpha sIL-15R-alpha sIL-15RA Soluble interleukin 15 receptor subunit alpha Soluble interleukin-15 receptor subunit alpha |
Description | Recombinant Human IL15RA Protein (Fc Tag Active) was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | MAPRRARGCRTLGLPALLLLLLLRPPATRGITCPPPMSVEHADIWVKSYS LYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALV HQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGS QLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQG HSDTT |
Molecular Weight | 45 kDa including tags |
Purity | >95% by SDS-PAGE . |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Immobilized this protein at (100 μl/well) can bind biotinylated human IL-15, Fc Tag, Avi Tag with a linear range of 2-78 ng/ml. It inhibits IL-15-dependent proliferation of CTLL-2 cells. The ED50 for this effect is 2.77-4.20 ng/ml. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle. |
Target Details
Target Function | High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. In neutrophils, binds and activates kinase SYK in response to IL15 stimulation. In neutrophils, required for IL15-induced phagocytosis in a SYK-dependent manner. Expression of different isoforms may alter or interfere with signal transduction.; Does not bind IL15.; Does not bind IL15.; Does not bind IL15.; Does not bind IL15. |
Subcellular Location | Membrane; Single-pass type I membrane protein. Nucleus membrane; Single-pass type I membrane protein. Cell surface. Note=Mainly found associated with the nuclear membrane.; [Isoform 5]: Endoplasmic reticulum membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass type I membrane protein. Cytoplasmic vesicle membrane; Single-pass type I membrane protein. Membrane; Single-pass type I membrane protein. Note=Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane.; [Isoform 6]: Endoplasmic reticulum membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass type I membrane protein. Cytoplasmic vesicle membrane; Single-pass type I membrane protein. Membrane; Single-pass type I membrane protein. Note=Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane.; [Isoform 7]: Endoplasmic reticulum membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass type I membrane protein. Cytoplasmic vesicle membrane; Single-pass type I membrane protein. Membrane; Single-pass type I membrane protein. Note=Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane.; [Isoform 8]: Endoplasmic reticulum membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass type I membrane protein. Cytoplasmic vesicle membrane; Single-pass type I membrane protein. Membrane; Single-pass type I membrane protein. Note=Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane.; [Soluble interleukin-15 receptor subunit alpha]: Secreted, extracellular space. |
Database References | |
Tissue Specificity | Expressed in neutrophils (at protein level). Expressed in fetal brain with higher expression in the hippocampus and cerebellum than in cortex and thalamus. Higher levels of soluble sIL-15RA form in comparison with membrane-bound forms is present in all br |
Gene Functions References
- Men with the IL-15Ralpha 1775AA genotype spent more time in light intensity physical activity (39.4 +/- 2.4 hr/week) than men with the CC genotype (28.6 +/- 2.3 hr/week, (p = .009). PMID: 29624921
- this study describes variants of splicing of IL-15Ra expressed in intestinal epithelial cells, and identifies those variants with the ability of binding IL-15 and following the secretory pathway, as well as determines if any of these variants are regulated by methylation of DNA PMID: 27794069
- significant association of rs2228059 with ossification of the posterior longitudinal ligament of the spine in Chinese Han population PMID: 25387549
- Report Il15Ralpha levels in synovial fluid from rheumatoid arthritis patients. PMID: 25879761
- NK cell activation in human hantavirus infection explained by virus-induced IL-15/IL15Ralpha expression PMID: 25412359
- Coexpression of IL15RA and IL15 was also sufficient to activate peripheral blood mononuclear cells. PMID: 24980552
- our study provides strong evidence that the functional IL-15RA rs2228059 A>C polymorphism may contribute to the risk of ESCC. PMID: 24464181
- We show that a gene transfer approach using recombinant adenovirus to express IL-15 and IL-15Ralpha in murine TRAMP-C2 prostate or TS/A breast tumors induced antitumor immune responses PMID: 24572789
- This present study demonstrated that IL15RA rs2228059 A > C polymorphism might modify Gastric cardiac adenocarcinoma susceptibility PMID: 24696261
- The proportion of IL-15Ralpha expression on total leukocytes was much lower for all rheumatic diseases, including Behcet disease, than in healthy controls PMID: 23417200
- Single nucleotide polymorphism in IL15RA gene is associated with ER-positive breast cancers only in American women of African ancestry. PMID: 23996684
- lower frequencies of IL-15RA-positive T cells in Behcet's disease PMID: 23618691
- Epidermal IL-15Ralpha acts as an endogenous antagonist of psoriasiform inflammation in mouse and man. PMID: 24019554
- The inflammatory bowel diseases patients have an increased expression of IL-15Ralpha mRNA in the mucosa; expression is localized in B cells, suggesting that IL-15 regulates B-cell functions during bowel inflammation. PMID: 23039249
- The expression of IL-15Ralpha on CD8 T cells is required for uncontrolled aggressive lymphoproliferation; none of the IL-15Ralpha(-/-)-IL-15 mice that we followed for more than 2 years developed the fatal disease despite controlled expansion of CD8 T cells PMID: 21304101
- IL-15 is produced and secreted only as a heterodimer with IL-15Ralpha. PMID: 22496150
- High serum IL-15R alpha is associated with T-cell large granular lymphocyte leukemia. PMID: 22049515
- These results suggest that IL15RA polymorphism may be associated with the susceptibility of ossification of the posterior longitudinal ligament in Korean population. PMID: 21689944
- Different levels of IL-15 trans-presentation are required for different natural killer (NK) cell developmental events to reach full maturation status PMID: 21715685
- broad expression pattern of functional IL-15RA splicing forms and suggests a regulatory role of DNA methylation in IL-15RA transcript Var1 expression in mononuclear cells PMID: 21097393
- mRNA for IL-15 receptor alpha was constitutively expressed in all tested human fetal brain structures, indicating a role in their development and physiology PMID: 12114302
- interleukin-15alpha receptor binds to IL-15 at specific binding sites, one in the B helix and the other in the C helix PMID: 15039446
- Soluble IL-15R alpha arises from proteolytic shedding of the membrane-anchored receptor. It is an inhibitor of IL-15 binding to the membrane receptor & of IL-15-induced cell proliferation. IL-15R alpha shedding may have major immunoregulatory functions. PMID: 15265897
- IL-15 is an important mediator of muscle mass response to resistance exercise training in humans and that genetic variation in IL15RA accounts for a significant proportion of the variability in this response. PMID: 15531573
- Study of three-dimensional structure of IL-15 receptor (IL-15R) alpha chain has led to a model of the IL-15.IL-15R alpha complex that reveals involvement of a large network of ionic interactions not observed in other cytokine/cytokine receptor complexes. PMID: 16377614
- Results show that the biological activity of soluble IL-15 is much improved after interaction with recombinant soluble IL-15Ralpha. PMID: 16757567
- Data show that NK cell survival mediated through the regulatory synapse with human dendritic cells requires IL-15Ralpha. PMID: 17948125
- sIL-15Ralpha has a protumor role in cancer PMID: 18483276
- genetic variability of the IL-15 receptor has an important role in body fat composition. PMID: 19309557
- IL-15 receptor alpha facilitates the stability and secretion of the IL-15 short signal peptide, a soluble and bioactive isoform. PMID: 19696432