Recombinant Human IFNW1 Protein
Beta LifeScience
SKU/CAT #: BLA-0301P
Recombinant Human IFNW1 Protein
Beta LifeScience
SKU/CAT #: BLA-0301P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P05000 |
Synonym | IFNW1 IFNW1_HUMAN Interferon alpha II 1 Interferon alpha-II-1 Interferon omega 1 Interferon omega-1 |
Description | Recombinant Human IFNW1 Protein was expressed in HEK293. It is a Full length protein |
Source | HEK293 |
AA Sequence | LGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQL QKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLET CLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEI MKSLFLSTNMQERLRSKDRDLGSSVDHHHHHH |
Molecular Weight | 21 kDa including tags |
Purity | >95% SDS-PAGE.Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. The lyo |
Target Details
Subcellular Location | Secreted. |
Protein Families | Alpha/beta interferon family |
Database References |
Gene Functions References
- a review on current status in clinical applications of interferon-omega PMID: 28957693
- Single nucleotide polymorphism in ACO1 gene is associated with skin pigmentation. PMID: 20574843
- Data show that a novel c.1344delC mutation in AIRE and anti-IFN-omega antibodies appear very early in life are helpful to differentiate APS I from other multi-organ autoimmune diseases. PMID: 19863576