Recombinant Human IFNAR2 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-0294P
Recombinant Human IFNAR2 Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-0294P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P48551 |
Synonym | Human interferon alpha/beta receptor IFN alpha REC IFN R IFN-a/βR2 IFN-a/βRβ IFN-alpha binding protein IFN-alpha/beta receptor 2 IFN-R-2 IFNABR IFNAR2 IFNARB IFNR INAR2_HUMAN Interferon (alpha beta and omega) receptor 2 Interferon alpha binding protein Interferon alpha/beta receptor 2 Interferon alpha/beta receptor beta chain Type I interferon receptor Type I interferon receptor 2 |
Description | Recombinant Human IFNAR2 Protein (Fc Tag) was expressed in Mammalian. It is a Protein fragment |
Source | Mammalian |
AA Sequence | ISYDSPDYTDESCTFKISLRNFRSILSWELKNHSIVPTHYTLLYTIMSKP EDLKVVKNCANTTRSFCDLTDEWRSTHEAYVTVLEGFSGNTTLFSCSHNF WLAIDMSFEPPEFEIVGFTNHINVMVKFPSIVEEELQFDLSLVIEEQSEG IVKKHKPEIKGNMSGNFTYIIDKLIPNTNYCVSVYLEHSDEQAVIKSPLK CTLLPPGQESESAESAKVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPS VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKT KPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQK SLSLSPGK |
Molecular Weight | 52 kDa including tags |
Purity | >95% SDS-PAGE.Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Associates with IFNAR1 to form the plasma membrane receptor in the type I interferon signaling pathway. Directly involved in signal transduction through its association with the TYR kinase JAK1. Involved in interferon-mediated STAT1, STAT2 and STAT3 activation.; Potent inhibitor of type I IFN receptor activity. |
Subcellular Location | [Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Cell membrane; Single-pass type I membrane protein.; [Isoform 3]: Secreted. |
Protein Families | Type II cytokine receptor family |
Database References | |
Associated Diseases | Immunodeficiency 45 (IMD45) |
Tissue Specificity | Isoform 3 is detected in the urine (at protein level). Expressed in blood cells. Expressed in lymphoblastoid and fibrosarcoma cell lines. |
Gene Functions References
- The findings underline the roles of UL36USP-IFNAR2 interaction in counteracting the type I IFN-mediated signaling pathway and reveal a novel evasion mechanism of antiviral innate immunity by HSV-1. PMID: 29997210
- Report lowered serum IFNAR2 levels in multiple sclerosis patients are elevated on treatment with interferon-beta. PMID: 27613121
- this study shows that the surface expression levels of the common IFN-alpha/beta receptor subunit 2 are significantly higher on plasmacytoid dendritic cells from females in comparison to males PMID: 27891600
- A very small percentage of the pancreatic tumors showed strong expression of the IFNAR-2c. PMID: 25072284
- Lack of expression of functional IFNAR2 does not seem to be the major cause of interferon resistance in hepatitis C virus patients receiving standard interferon therapy. PMID: 26176069
- The effects of two functional polymorphisms, type I interferon receptor 2 gene (IFNAR2)-F8S and interleukin-10 receptor subunit beta gene (IL10RB)-K47E, on chronic hepatitis B virus (HBV) infection, were investigated. PMID: 23745570
- IFNAR2 overexpression was observed in various histological types of lung cancer, and appears to be associated with lung cancers that behave aggressively. PMID: 22236545
- In this study we have characterized the Stat2-IFNaR2 interaction and examined its role in IFNalpha signaling PMID: 11786546
- STAT3 activation by type I interferons is dependent on specific tyrosines located in the cytoplasmic domain of interferon receptor chain 2c PMID: 12105218
- Expression and signaling activity of interferon alpha/beta receptors modulates dendritic cell (DC) responsiveness during terminal maturation and differentiation of monocyte-derived DCs. PMID: 12218119
- Subunit 2 of the interferon alpha receptor (IFNaR2) is bound more avidly to Stat2 than is phosphorylated IFNaR1. PMID: 12220192
- Administration as a complex with sIFNAR-2 may provide a method of enhancing the delivery and effectiveness of type I interferons in Burkitt lymphoma in scid mice. PMID: 14980076
- IFNaR2, a subunit of the type I IFN receptor, is proteolytically cleaved in a regulated manner. PMID: 15286706
- Dynamics of the IFNAR2 extracellular domain binding site reveal highly flexible loop segments and a malleable binding surface interacting with the IFN ligand supported by a more rigid scaffold which stabilizes the binding site conformation. PMID: 15287740
- A dynamic model for the IFN-alpha/receptor complex predicts that IFNAR2 and IFNAR1 are probably anchored in close proximity on the cell surface and that upon IFN binding, the complex assumes a closed form, resulting in activation of intracellular kinases. PMID: 15449939
- IFNaR2 intracellular domain transcriptional modulation is dependent upon the carboxyl-terminal transactivation domain of Stat2. PMID: 15717316
- Rapid inhibition of MAPK signaling and anti-proliferation effect via JAK/STAT signaling by interferon-alpha in hepatocellular carcinoma cell lines. PMID: 16054712
- Oveexpression of IFNAR2 is associated with hepatocellular carcinoma PMID: 16106266
- Hepatic IFNAR2c mRNA expression appears to correlate inversely with the fibrosis stage and age in hepatitis C infection. PMID: 16518956
- Monocyte-derived dendritic cells can modulate their sensitivity to two IFN subtypes by differential regulation of the IFNAR subunits. PMID: 16624932
- IFNAR2 cytoplasmic domain serves to link STAT4 to the IFNAR as a pre-assembled complex that facilitates cytokine-driven STAT4 activation. PMID: 17095088
- binding of IFN-alpha8 rather than binding of IFN-alpha2 to IFNAR-2 leads to activation and subsequent antiproliferative activity despite the same antiviral activity in renal cell carcinoma PMID: 17572016
- The intensity and distribution of IFNAR-2 may predict the response to therapy with IFN-alpha and IFN-beta in pancreatic cancer. PMID: 17667505
- High IFNAR2 is associated with renal cell carcinoma metastasis PMID: 17697365
- Results demonstrated that FNAR2-extracellular domain interact differentially with two individual IFN-alphas, suggesting the mutual interaction between multiple IFN-alpha subtypes during the competition for binding to the receptor. PMID: 18027911
- The data suggest that liberation of the IFNaR2-ICD by regulated proteolysis could trigger a novel mechanism for moving the transcription factor Stat2 to the nucleus. PMID: 18456457
- The Stat3-activating Tyk2 V678F mutant does not up-regulate signaling through the type I interferon receptor but confers ligand hypersensitivity to a homodimeric receptor PMID: 18456658
- Findings show that interferon-alpha/beta receptor (IFNAR)-2 isoforms are important regulators of the responsiveness to endogenous and systemically administered interferon beta (IFNbeta). PMID: 18971450
- Results suggest that zinc, especially polaprezinc, enhances the expression of type 1 interferon 2 receptor in U937 cells, thereby inducing production of the anti-viral protein 2'-5'OAS. PMID: 19362011
- Ep-CAM is a potentially useful marker for resistance to INFalpha/5-FU therapy, especially in IFNAR2-positive cases. PMID: 19401692
- The IFNAR2-8SS genotype was associated with HBeAg negative patients; IFNAR2-8F allele was associated with the risk to high viral loads; the IFNAR2-8FF genotype predisposed to higher MxA gene induction and correlated with sustained IFN response. PMID: 19714778