Recombinant Human Hyaluronan And Proteoglycan Link Protein 1 (HAPLN1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09305P

Greater than 85% as determined by SDS-PAGE.

Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Mammalian Cell-expressed Homo sapiens (Human) HAPLN1.

Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Mammalian Cell-expressed Homo sapiens (Human) HAPLN1.
Recombinant Human Hyaluronan And Proteoglycan Link Protein 1 (HAPLN1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09305P
Collections: High-quality recombinant proteins, Other recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Hyaluronan And Proteoglycan Link Protein 1 (HAPLN1) Protein (His) is produced by our Mammalian cell expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P10915 |
Target Symbol | HAPLN1 |
Synonyms | Cartilage link protein ; cartilage linking protein 1 ; Cartilage-link protein; Cartilage-linking protein 1; CLP; CRTL1 ; Crtl1l; HAPLN1; HPLN1_HUMAN; Hyaluronan and proteoglycan link protein 1; Hyaluronan and proteoglycan link protein 1 precursor ; LP; Proteoglycan link protein |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | N-10His |
Target Protein Sequence | DHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN |
Expression Range | 16-354aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 41.0 kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the extracellular cartilage matrix. |
Subcellular Location | Secreted, extracellular space, extracellular matrix. |
Protein Families | HAPLN family |
Database References | |
Tissue Specificity | Widely expressed. Weakly expressed in the brain. |
Gene Functions References
- HAPLN1 reflects a signaling network leading to stemness, mesenchymal commitment and hepatocellular carcinoma progression PMID: 27191501
- CSGalNAcT-1 and Hapln-1 may play important roles in the pathogenesis of Kashin-Beck disease and osteoarthritis. PMID: 23748413
- HAPLN1 is overexpressed in metastatic melanoma and is secreted exclusively by the tumor cells PMID: 22159717
- Single-nucleotide polymorphism in the hyaluronan and proteoglycan link protein 1 (HAPLN1) gene is associated with spinal osteophyte formation and disc degeneration in Japanese women. PMID: 20953637
- An in vitro model of perineuronal nets has been developed demonstrating that cartilage link protein (along with hyaluronan synthase) are necessary for their formation. PMID: 20584105
- link protein may function as a stabilizer of the interaction between aggrecan and hyaluronan in cartilage and between versican and hyaluronan in many tissues PMID: 14724283
- SOX9 is a key regulator of CRTL1 PMID: 15456769
- cLP and versican did not bind directly to each other in solution yet formed ternary complexes with hyaluronan PMID: 15590670
- Overexpression of HAPLN1 and its SP-IgV domain increases tumorigenic properties of mesothelioma. Thus, targeting the SP-IgV domain may be one of the therapeutic approaches in cancer treatment. PMID: 19351750