Recombinant Human Hyaluronan And Proteoglycan Link Protein 1 (HAPLN1)

Beta LifeScience SKU/CAT #: BLC-00471P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Human Hyaluronan And Proteoglycan Link Protein 1 (HAPLN1)

Beta LifeScience SKU/CAT #: BLC-00471P
Save $407
/
Size

Product Overview

Description Recombinant Human Hyaluronan And Proteoglycan Link Protein 1 (HAPLN1) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb P10915
Target Symbol HAPLN1
Species Homo sapiens (Human)
Expression System E.coli
Tag Tag-Free
Target Protein Sequence DHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN
Expression Range 16-354aa
Protein Length Full Length of Mature Protein
Mol. Weight 38.6 kDa
Research Area Signal Transduction
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the extracellular cartilage matrix.
Subcellular Location Secreted, extracellular space, extracellular matrix.
Protein Families HAPLN family
Database References
Tissue Specificity Widely expressed. Weakly expressed in the brain.

Gene Functions References

  1. HAPLN1 reflects a signaling network leading to stemness, mesenchymal commitment and hepatocellular carcinoma progression PMID: 27191501
  2. CSGalNAcT-1 and Hapln-1 may play important roles in the pathogenesis of Kashin-Beck disease and osteoarthritis. PMID: 23748413
  3. HAPLN1 is overexpressed in metastatic melanoma and is secreted exclusively by the tumor cells PMID: 22159717
  4. Single-nucleotide polymorphism in the hyaluronan and proteoglycan link protein 1 (HAPLN1) gene is associated with spinal osteophyte formation and disc degeneration in Japanese women. PMID: 20953637
  5. An in vitro model of perineuronal nets has been developed demonstrating that cartilage link protein (along with hyaluronan synthase) are necessary for their formation. PMID: 20584105
  6. link protein may function as a stabilizer of the interaction between aggrecan and hyaluronan in cartilage and between versican and hyaluronan in many tissues PMID: 14724283
  7. SOX9 is a key regulator of CRTL1 PMID: 15456769
  8. cLP and versican did not bind directly to each other in solution yet formed ternary complexes with hyaluronan PMID: 15590670
  9. Overexpression of HAPLN1 and its SP-IgV domain increases tumorigenic properties of mesothelioma. Thus, targeting the SP-IgV domain may be one of the therapeutic approaches in cancer treatment. PMID: 19351750

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

More from Beta LifeScience's Promotion
Western Blot | Positive WB detected in: MCF-7 whole cell lysate, A549 whole cell lysate, Mouse thymus | All lanes: ACAA2 antibody at 1:2000 | Secondary | Goat polyclonal to rabbit IgG at 1/50000 dilution | Predicted band size: 42 kDa | Observed band size: 42 kDa
IHC image of ACAA2 Recombinant Monoclonal Antibody diluted at 1:100 and staining in paraffin-embedded human colon cancer performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a Goat anti-rabbit polymer IgG labeled by HRP and visualized using 0.05% DAB.
ACAA2 Recombinant Monoclonal Antibody
CAT#: BLC-06609A
IHC image of the antibody diluted at 1:100 and staining in paraffin-embedded human breast cancer performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a Goat anti-rabbit polymer IgG labeled by HRP and visualized using 0.07% DAB.
IHC image of Acetyl-HIST1H3A(K18) Recombinant Monoclonal Antibody diluted at 1:100 and staining in paraffin-embedded human gastric cancer performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a Goat anti-rabbit polymer IgG labeled by HRP and visualized using 0.07% DAB.
Acetyl-HIST1H3A(K18) Recombinant Monoclonal Antibody
CAT#: BLC-06595A
Western BlotPositive WB detected in:293 whole cell lysate, HepG2 whole cell lysate, Mouse kidney tissueAll lanes:Acetyl-Histone H4 (K16) antibody at 1.65μg/mlSecondaryGoat polyclonal to rabbit IgG at 1/50000 dilutionPredicted band size: 11 KDaObserved band size: 11 KDa
Immunocytochemistry analysis of Acetyl-Histone H4 (K16) Recombinant Monoclonal Antibody diluted at 1:100 and staining in Hela cells performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4℃ overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
Acetyl-Histone H4 (K16) Recombinant Monoclonal Antibody
CAT#: BLC-06518A
Western BlotPositive WB detected in:293 whole cell lysate, HepG2 whole cell lysate, Mouse kidney tissueAll lanes:Acetyl-Histone H4 (K16) antibody at 1.65μg/mlSecondaryGoat polyclonal to rabbit IgG at 1/50000 dilutionPredicted band size: 11 KDaObserved band size: 11 KDa
Immunocytochemistry analysis of Acetyl-Histone H4 (K16) Recombinant Monoclonal Antibody diluted at 1:100 and staining in Hela cells performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4℃ overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
Acetyl-Histone H4 (K16) Recombinant Monoclonal Antibody
CAT#: BLC-06519A
Western BlotPositive WB detected in:293 whole cell lysate, HepG2 whole cell lysate, Mouse kidney tissueAll lanes:Acetyl-Histone H4 (K16) antibody at 1.65μg/mlSecondaryGoat polyclonal to rabbit IgG at 1/50000 dilutionPredicted band size: 11 KDaObserved band size: 11 KDa
Immunocytochemistry analysis of Acetyl-Histone H4 (K16) Recombinant Monoclonal Antibody diluted at 1:100 and staining in Hela cells performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4℃ overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
Acetyl-Histone H4 (K16) Recombinant Monoclonal Antibody
CAT#: BLC-06520A
Western Blot | Positive WB detected in Hela whole cell lysate, MCF-7 whole cell lysate, 293 whole cell lysate, HepG2 whole cell lysate | All lanes Acetyl-Histone H4 (K5) antibody at 1.05μg/ml | Secondary | Goat polyclonal to rabbit IgG at 1/50000 dilution | Predicted band size: 11 KDa | Observed band size: 11 KDa
Immunocytochemistry analysis of Acetyl-Histone H4 (K5) Recombinant Monoclonal Antibody diluted at 1:100 and staining in Hela cells performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4℃ overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
Acetyl-Histone H4 (K5) Recombinant Monoclonal Antibody
CAT#: BLC-06516A
Recently viewed