Recombinant Human Huntingtin Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-4760P
Recombinant Human Huntingtin Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-4760P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P42858 |
Synonym | AI256365 C430023I11Rik HD HD protein HD_HUMAN HDH HTT Huntingtin HUNTINGTON CHOREA Huntington disease protein Huntington's disease protein homolog IT 15 IT15 OTTMUSP00000026909 ZHD |
Description | Recombinant Human Huntingtin Protein (Tagged) was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIA MELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNG APRSLRAALW |
Molecular Weight | 38 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | useful for Antibody Production and Protein Array |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |