Recombinant Human HSD11B1 Protein

Name: Recombinant Human HSD11B1 Protein
Brand: Beta LifeScience
SKU: BLA-4680P
Availability: InStock

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	P28845
Synonym	11 beta HSD 1 11 beta HSD1 11 beta hydroxysteroid dehydrogenase 1 11 DH 11-beta hydroxysteroid dehydrogenase, type 1 11-beta-HSD1 11-beta-hydroxysteroid dehydrogenase 1 11-DH 11DH Corticosteroid 11 beta dehydrogenase isozyme 1 Corticosteroid 11-beta-dehydrogenase isozyme 1 CORTRD2 DHI1_HUMAN HDL HSD 11 HSD11 HSD11B HSD11B1 HSD11L Hydroxysteroid (11 beta) dehydrogenase Hydroxysteroid (11 beta) dehydrogenase 1 MGC13539 SDR26C1 short chain dehydrogenase/reductase family 26C, member 1
Description	Recombinant Human HSD11B1 Protein was expressed in Wheat germ. It is a Full length protein
Source	Wheat germ
AA Sequence	MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREM AYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAE QFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVL TVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKE YSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGA LRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK
Molecular Weight	58 kDa including tags
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Catalyzes reversibly the conversion of cortisol to the inactive metabolite cortisone. Catalyzes reversibly the conversion of 7-ketocholesterol to 7-beta-hydroxycholesterol. In intact cells, the reaction runs only in one direction, from 7-ketocholesterol to 7-beta-hydroxycholesterol.
Subcellular Location	Endoplasmic reticulum membrane; Single-pass type II membrane protein.
Protein Families	Short-chain dehydrogenases/reductases (SDR) family
Database References	HGNC: 5208 OMIM: 600713 KEGG: hsa:3290 STRING: 9606.ENSP00000261465 UniGene: PMID: 28793178 The authors show that lipoproteins including brain (apoE) and circulating (high-density lipoprotein, HDL) synergize to facilitate beta-amyloid transport across bioengineered human cerebral vessels. PMID: 28994390 results indicated that the HSD11B1 rs12086634 is associated with both type 2 diabetes (T2D) and metabolic syndrome (metS) but HSD11B1 rs846910 is associated with only T2D in South Indian population PMID: 28750217 The present study shows the temporal localisation of 11beta-HSD1 in uterus, highlighting its importance in the timing of gestation and suggesting its contribution in the myometrium contraction. PMID: 28237720 Neuroticism was associated with the rs12565406 polymorphism and had a mediatory role in the association between the polymorphism and postpartum depression. This finding elucidates the genetic background of neuroticism and postpartum depression. PMID: 27721188 This mini-review will focus on 11beta-HSD1 in skeletal muscle and its postulated link to obesity and insulin-resistance. PMID: 28765040 This study investigated the contribution of first trimester decidua to glucocorticoid availability at the fetal-maternal interface by assessing the expression and regulation of 11beta-HSD in human first trimester decidual tissues. PMID: 27544778 Moderate downregulation of 11beta-HSD1 can attenuate insulin insensitivity and the impairment of glucose-stimulated insulin secretion. PMID: 29078846 distributed extensively on the maternal side including decidual stromal cells and epithelial cells but scarcely on the fetal side except for localization in the fetal blood vessels of the chorionic villi PMID: 27697223 The reduction of DHT obese homozygotic twins could be linked to its increased degradation by AKR1C2 and HSD11B1, and increased estrogen levels could be linked to increased adiposity-related expression of aromatase in adipose tissue. PMID: 28619249 this study shows that the phenotypic switch of adipose tissue macrophages from M2 to mixed M1/M2 phenotype occurred through differentiation of adipocytes in obese individuals, and upregulation of intracellular 11beta-HSD1 might play a role in the process PMID: 27698011 11beta-HSD-2 plays an important role in the development of bone or osteoblast cell apoptosis, and the decreased expression of 11beta-HSD-2 may aggravate steroid induced bone/osteoblast cell apoptosis. PMID: 28698139 11beta-HSD1 may be an important enzyme in the pathogenesis of fatty liver and visceral obesity. PMID: 27715400 In HSD11B1 gene of rs3753519-stratified analysis, carriers of the minor allele presented significantly increased BMI, fasting plasma glucose and HOMA-IR. The study provides support for plausible implication of the HSD11B1 polymorphisms in susceptibility to develop undesirable effects of glucocorticoid replacement in Addison's disease. PMID: 27083553 Increased 11beta-HSD1 expression and its reductase activity in granulosa cells are the major causes of increased cortisol concentration in the follicular fluid of PCOS with insulin resistance. PMID: 26934392 Reciprocal regulation of the glucocorticoid metabolizing enzymes, 11beta-hydroxysteroid dehydrogenase types 1 and 2, is associated with steroid-responsiveness and disease remission in childhood nephrotic syndrome. PMID: 27507896 increased cortisol and 11beta-HSD1 abundance and decreased LOX abundance were observed in human amnion tissue after the labor-initiated spontaneous rupture of membranes PMID: 27533889 These findings indicated that 11beta-HSD1 inhibition can give a potential benefit in reducing obesity and lowering insulin resistance by modulating the insulin-signaling pathway and adipocytokine production. PMID: 27268236 Review of the role of HSD11B1 in pregnancy complications, fetal diseases, and later life morbidity. PMID: 27018008 the infiltration of macrophages in the form of crown-line structures in subcutaneous adipose tissue is associated with increased 11BHSD1 levels. It may be an important mechanism in the development of metabolic disorders. PMID: 27219880 hyperactive hypothalamo-pituitary-adrenocortical axis in overweight diabetic subjects may be associated with downregulation of 11beta-HSD1, MR, and GR in the brain. PMID: 26212138 ins4436A in the HSD11B1 gene is associated with essential hypertension in a Polish population PMID: 26671915 the availability of H6PDH determines the different direction of 11beta-HSD1 in liver and Leydig cells. PMID: 26528718 we also found a significant difference between AA and AG genotype of rs6688832 and the AG genotype was associated with hyperandrogenism, but no statistical different distribution of polymorphism rs17368528 of H6PD and rs846908 of HSD11B1 were observed PMID: 26452272 11beta-HSD1 expressed in polyp-derived epithelial cells may be involved in the anti-inflammatory function of glucocorticoid in the treatment of nasal polyps, which contributes to increased levels of endogenous cortisol. PMID: 26163245 Our work is one of the first comprehensive views of DNA methylation and expression in the placenta for both HSD11B types 1 and 2, linking epigenetic alterations with the regulation of fetal stress and birth weight outcomes. PMID: 25788665 Ultra-fast Shape Recognition with Atom Types--the discovery of novel bioactive small molecular scaffolds for FKBP12 and 11betaHSD1. PMID: 25659145 Our results indicate that HSD11B1 polymorphisms may contribute toward the development of MetS in psychiatric patients treated with potential weight gain-inducing psychotropic drugs, but do not play a significant role in the general population PMID: 25751397 Glucocorticoids and 11beta-hydroxysteroid dehydrogenases: mechanisms for hypertension PMID: 25666420 This review describes the body of work performed over the past decade detailing the importance and regulation of HSD11B1 in humans, and its relevance to metabolic disease. [review] PMID: 25436731 Promoter SNPs of the HSD11B1 gene might exert a potential genetic protective role against the development of PCOS, possibly via their beneficial effect on carbohydrate homeostasis due to facilitation of insulin efflux from pancreatic beta-cells. PMID: 24969481 Skeletal muscle 11beta-HSD1 is up-regulated with age in women and is associated with reduced grip strength, insulin resistance, and an adverse body composition profile. PMID: 25989394 The polymorphism of HSD11B1 may be a cause of childhood obesity, or even associated with the complication of childhood obesity. PMID: 24729284 Although cerebral 11betaHSD1 reductase activity may be greater in cognitively impaired patients, in healthy men any contribution of 11betaHSD1 in the brain to systemic cortisol/cortisone turnover is negligible. PMID: 25393644 placental gene expression of 11bHSD-1 may be indirectly connected with infantile growth via adiponectin-associated metabolic regulation represented by adiponectin levels in umbilical cord blood. PMID: 24147632 These results indicate that chronic rhinosinusitis -relevant cytokines can modulate the expression of 11beta-HSD1, 11beta-HSD2, and CYP11B1 in the sinus mucosa, resulting in increasing intracellular concentrations of bioactive glucocorticoids. PMID: 24810847 Polymorphisms in the 11betaHSD1 and NR3C1 genes were associated with impaired cognitive function in Cushings syndrome. PMID: 24915124 Development of specific inhibitors targeting 11beta-HSD1 might be a promising way to improve impaired insulin-stimulated glucose uptake. PMID: 24122936 In African Americans, but not Hispanics, subcutaneous adipose tissue 11betaHSD1 is associated with insulin sensitivity and disposition index, and might be mediated by hepatic fat fraction. PMID: 23836520 Increased skeletal muscle 11betaHSD1 mRNA is associated with lower muscle strength in aging. PMID: 24391882 The expression levels of 11beta-HSD1, CYP11B1, and cortisol were up-regulated in mild and moderate/severe persistent allergic nasal mucosa. PMID: 24447082 Pro-inflammatory cytokine induction of 11beta-hydroxysteroid dehydrogenase type 1 in A549 cells requires phosphorylation of C/EBPbeta at Thr235. PMID: 24086653 in a South Indian population, a polymorphism of the HSD11B1 gene containing the single-nucleotide polymorphism (SNP) rs12086634 T-->G may have a role in metabolic syndrome PMID: 23869418 Data suggest that HSD11B1 expression and activity in fetal membranes during prolonged pregnancy are similar in women who enter labor spontaneously or who respond to labor induction; HSD11B1 expression and activity are low in non-responders. PMID: 24054540 The aim of the work was to investigate the expression of HSD11B1, HSD11B2, H6PDH, and glucocorticoids receptor (GR) mRNA in subcutaneous adipose tissue (SAT) from obese women with or without polycystic ovary syndrome. PMID: 23979790 Data suggest that males exhibit higher HSD11B1 activity in cultured adipocytes than females; no such difference was observed in biopsy samples of subcutaneous adipose tissue; HSD11B1 expression correlates with insulin resistance and adiposity. PMID: 23701286 A variant (rs932335) in the HSD11B1 gene is associated with colorectal cancer. PMID: 24061267 Two critical enzymes 11beta-HSD1 and 11beta-HSD2 that regulate glucocorticoid activities are expressed inversely in malignant hepatocytes, resulting in the inactivation of endogenous glucocorticoids and the loss of gluconeogenesis. PMID: 24149070 Genetic variations in HSD11B1 may affect the physiological cortisol levels and the severity of age-related osteoporosis. PMID: 24285685 CBX treatment inhibited the stimulatory effects of BPA (at 10 nM) on PPAR-gamma and LPL mRNA expression, whereas RU486 inhibited 11beta-HSD1 mRNA expression in the adipocytes. PMID: 23090578

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human HSD11B1 Protein

Recombinant Human HSD11B1 Protein

Product Overview

Target Details

FAQs