Recombinant Human Homeobox Protein Nkx-2.1 (NKX2-1) Protein (His&Myc)

Name: Recombinant Human Homeobox Protein Nkx-2.1 (NKX2-1) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-11172P
Availability: InStock

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NKX2-1.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Homeobox Protein Nkx-2.1 (NKX2-1) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P43699
Target Symbol	NKX2-1
Synonyms	AV026640; BCH; Benign chorea ; BHC; Homeobox protein NK 2 homolog A; Homeobox protein NK-2 homolog A; Homeobox protein Nkx 2.1; Homeobox protein Nkx-2.1; Homeobox protein Nkx2.1; NK 2; NK 2 homolog A; NK2; NK2 homeobox 1; NK2; drosophila; homolog of; A; NK2.1; mouse; homolog of; Nkx 2 1; NKX 2.1; NKX 2A; NKX2 1; Nkx2-1; NKX2.1; NKX21_HUMAN; NKX2A; T EBP; T/EBP; TEBP; Thyroid nuclear factor 1; Thyroid nuclear factor; Thyroid specific enhancer binding protein; Thyroid transcription factor 1; Tin man; Tinman; TITF 1; TITF1; TTF 1; TTF-1; TTF1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGTGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQGHAQQQAQHQAQAAQAAAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHLNSSGSDYGTMSCSTLLYGRTW
Expression Range	1-371aa
Protein Length	Full Length
Mol. Weight	46.0 kDa
Research Area	Epigenetics And Nuclear Signaling
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Transcription factor that binds and activates the promoter of thyroid specific genes such as thyroglobulin, thyroperoxidase, and thyrotropin receptor. Crucial in the maintenance of the thyroid differentiation phenotype. May play a role in lung development and surfactant homeostasis. Forms a regulatory loop with GRHL2 that coordinates lung epithelial cell morphogenesis and differentiation. Activates the transcription of GNRHR and plays a role in enhancing the circadian oscillation of its gene expression. Represses the transcription of the circadian transcriptional repressor NR1D1.
Subcellular Location	Nucleus.
Protein Families	NK-2 homeobox family
Database References	HGNC: 11825 OMIM: 118700 KEGG: hsa:7080 STRING: 9606.ENSP00000346879 UniGene: PMID: 30004050 NKX2-1 expression was upregulated in never-smokers , lung adenocarcinoma and patients with wild-type TP53. A negative correlation between NKX2-1 and miR-365 expression was found but there was no correlation between NKX2-1 and miR-33a expression. NKX2-1 expression impacts prognosis in early-stage non-small cell lung cancer patients, particularly in those with neither TP53 nor KRAS mutations. PMID: 29237428 Study shows that that NKX2-1 directly and positively regulates transcription of cyclin D1 in lung adenocarcinoma. Also, the expression of NKX2-1, but not cyclin D1, is significantly associated with metastatic incidence as an independent good prognostic factor of adenocarcinoma. PMID: 28634225 Case Report: TTF-1 expression in of a soft tissue metastasis of mediastinal non-functioning paraganglioma. PMID: 29517207 Loss of NKX2-1 is associated with cancer. PMID: 29587142 TTF-1 might be involved in lymph node metastasis of ovarian carcinomas in the presence of lymphangiogenesis PMID: 28843751 results indicate that TTF-1 expression in NECs suggests a possible role in their normal development and differentiation PMID: 25722034 Combined genomic and proteomic analyses demonstrated infrequent alteration of validated lung cancer targets but identified novel potential targets for TTF1-negative LUAD, including KEAP1/Nrf2 and DNA repair pathways PMID: 25878335 Low expression levels of TTF-1 is associated with lung adenocarcinoma. PMID: 25982999 Immunohistochemical comparison of two TTF-1 mAbs in atypical squamous lesions and sarcomatoid carcinoma of the lung, and pleural malignant mesothelioma suggest possibility for diagnostic errors. PMID: 26281863 Because TTF-1 is not detected in the vast majority of cases using a separate antibody clone, 8G7G3/1, we conclude that aberrant staining is due to cross-reactivity to unknown antigen(s). TTF-1 positivity and even Napsin A positivity, therefore, cannot be used as conclusive evidence of pulmonary origin and gastrointestinal origin must be considered in the differential diagnosis PMID: 26469324 CK7, TTF-1 and napsin A are predominantly expressed in primary lung adenocarcinoma patients, with CDX-2 being inconsistently expressed. PMID: 26469326 Study showed that TTF1 expression was upregulated in tumor tissues from patients with hepatocellular carcinoma (HCC) and that TTF1 mRNA levels were significantly associated with poor prognoses. Moreover, upregulation of TTF1 was shown to promote the proliferation of HCC cells in vitro. PMID: 26821084 P-AKT and TTF-1 using IHC had statistically significant correlation with EGFR mutation with high negative predictive value PMID: 26905105 TTF-1 positivity does not exclude the diagnosis of primary Olfactory neuroblastoma, although usually only a small percentage of cells are positive. PMID: 27543867 TTF-1 immunoreactivity was seen in 19 pulmonary neuroendocrine carcinoma (PNEC) cases (95%) and 13 thymic (TNEC) cases (59.1%). TTF-1 positivity was associated with high sensitivity but low specificity for PNEC, and adding PAX8 negativity significantly increased the specificity. PAX8 positivity alone showed essentially 100% specificity and 86.4% sensitivity for TNEC. PMID: 27761900 Studied the prognostic relevance of thyroid transcription factor 1 (TTF1) copy number alterations (CNAs) and expression levels in non-small cell lung cancer; found TTF1 CNAs and expression high within tumors and between primary and metastatic tumors. PMID: 28378892 it may be useful to combine NAPA and TTF-1 for increased sensitivity in lung cancer diagnostics. There is no substantial difference between monoclonal and polyclonal p40 and between different NAPA clones, whereas there is a difference between the TTF-1 clones 8G7G3/1 and SPT24 PMID: 26447895 TTF-1 shows significant potential as a diagnostic marker to differentiate metastatic pulmonary from non-pulmonary adenocarcinomas in pleural or other effusions. PMID: 26806377 Thyroid Transcription Factor 1 Alters the Expression Profiles of Cytokine and Angiogenic Factors of Lung Cancer Cells. PMID: 26912193 TTF1-expression had no significant impact on outcomes after irradiation of limited-disease small cell lung cancer. PMID: 27354614 our findings show that miR-532-5p is a novel transcriptional target of TTF-1 that plays a tumor suppressive role by targeting KRAS and MKL2 in lung adenocarcinoma PMID: 28474808 The genetic or epigenetic inactivation of NKX2-1/TTF-1 may play an essential role in the development and aberrant differentiation of non-TRU-type lung adenocarcinomas. PMID: 28677170 OLIG2 immunoreactivity was observed in GABAergic cells of the proliferative zones of the MGE and septum, but not necessarily co-expressed with NKX2.1, and OLIG2 expression was also extensively seen in the LGE, CGE, and cortex PMID: 27905023 the downregulation of NKX2-1 in IL-5+ NPs may be associated with tissue eosinophilia and goblet cells hyperplasia PMID: 28318118 In conclusion, TTF-1 is a useful marker in distinguishing subependymal giant cell astrocytoma from its mimics. Expression of TTF-1 in the fetal medial ganglionic eminence indicates that subependymal giant cell astrocytoma may originate from the progenitor cells in this region. PMID: 27910945 Low NKX2-1 expression is associated with thyroid carcinomas. PMID: 27036019 One familial cohort reported that Neuroendocrine cell hyperplasia of infancy (NEHI) is associated with a heterozygous variant of NKX2.1/TTF1. Four adult relatives with heterozygous NKX2.1 mutation and with clinical histories compatible with NEHI enrolled. Although clinical improvement occurs over time, NEHI may result in lifelong pulmonary abnormalities in some cases. PMID: 27187870 Patient-related factors modify the predisposition to papillary thyroid carcinoma by increasing the risk for rs944289 (near the NKX2-1 locus) per year of age, and by enhancing the protective effect of the FOXE1 GGT haplotype in men. PMID: 28660995 The homeobox domain-containing transcription factor NKX2.1 is highly expressed in the medial ganglionic eminence (MGE) and pre-optic area of the ventral subpallium and is essential for specifying cortical interneuron fate. PMID: 27539622 We demonstrated that the 14q13.2q21.1 deletion, which encompasses NKX2-1, but not FOXG1 gene and HPE8 region, identifies a well defined, more benign, microdeletion syndrome PMID: 27148860 Findings suggest that the novel non-transcriptional function of TTF-1 identified in this study may contribute to lung adenocarcinoma development by conferring tolerance to DNA RS, which is known to be inherently elicited by activation of various oncogenes. PMID: 28192407 Immunohistochemical detection of thyroid transcription factor 1, Napsin A, and P40 fragment of TP63 can be used in the subclassification of non-small cell lung carcinomas. PMID: 27045515 The rate of TTF-1-positive circulating tumor cells was strongly correlated with TNM staging, vascular infiltration, lymphatic metastasis, and the levels of CA125, CA15.3, and HE4 in endometrial carcinoma. PMID: 28039713 Study postulated that both TTF-1 and PAX-8 when co-expressed and have anti-proliferative and anti-tumorigenic properties up to a threshold expression level and beyond that, are able to induce pro-tumorigenic effects in thyroid carcinomas. PMID: 27573549 Results suggest that the thyroid transcription factor 1 expression was independently associated with progression-free survival and overall survival in patients with advanced-stage non-squamous non-small cell lung cancer treated with pemetrexed-based chemotherapy. PMID: 28218046 These findings describe recurrent NKX2-1 mutations in invasive mucinous adenocarcinomas of the lung and support NKX2-1 as a lineage-specific tumor suppressor gene in lung carcinogenesis. PMID: 26829311 Report TTF1 expression is common in combined Merkel cell carcinoma. PMID: 27322785 Preoperative serum miR-365 and TTF-1 mRNA levels may be effective indicators of tumor aggressiveness in human NSCLC. miR-365 and its target gene TTF-1 appear to be synergistic risk factors for the reduction in overall survival of patients with NSCLC. PMID: 26337230 In adenocarcinomas from extrahepatic biliary tract, there was no correlation between TTF-1 expression and the clinicopathological characteristics. PMID: 26316052 Suggest TTF-1 is a reliable marker in non-small cell lung carcinoma and can be used in differential diagnosis. PMID: 26456962 genetic susceptibility to thyroid cancer seems likely to be associated with the risk allele at rs944289 PMID: 26206751 EGFR knockdown led to upregulation of NKX2-1, suggesting a negative feedback loop. combined knockdown of NKX2-1 and EGFR in NCI-H1819 lung cancer cells reduced cell proliferation more than knockdown of either alone. PMID: 26556242 TTF-1 had no prognostic value concerning OS, but may serve as a predictor for response to first line chemotherapy in small cell lung cancer. PMID: 25889870 Authors suggest that NKX2-1 as a tumour suppressor or a tumour promoter in lung adenocarcinoma progression is dependent on p53 status. PMID: 25881545 TTF-1 is considered to be an excellent marker of pituicytes, specialized glia of the neurohypophysis. PMID: 25893822 Aberrant expression of mir-365/TTF-1 may be involved in the tumor development in patients with non-small cell lung carcinoma. PMID: 26045746 Different staining patterns can be seen with CK5/6 and p63; however, if they are used together with TTF-1 they can be used in subtyping lung neoplasms. PMID: 25944390 No TTF1 or EAP1 germline mutations were associated with central pubertal disorders. TTF1 and EAP1 may affect puberty by changing expression in response to other members of puberty-associated gene networks PMID: 24051510 Loss of TTF-1 is associated with low response to chemotherapy in non-small-cell lung cancer. PMID: 24457236

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Homeobox Protein Nkx-2.1 (NKX2-1) Protein (His&Myc)

Recombinant Human Homeobox Protein Nkx-2.1 (NKX2-1) Protein (His&Myc)

Product Overview

Target Details

FAQs