Recombinant Human Homeobox Protein Nanog (NANOG) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-11229P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Human Homeobox Protein Nanog (NANOG) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-11229P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Homeobox Protein Nanog (NANOG) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb Q9H9S0
Target Symbol NANOG
Synonyms Embryonic stem cell specific homeobox protein (Nanog); ENK; FLJ12581; hNanog; Homeobox protein NANOG; Homeobox transcription factor Nanog; homeobox transcription factor Nanog-delta 48; NANOG; Nanog homeobox; NANOG_HUMAN
Species Homo sapiens (Human)
Expression System E.coli
Tag N-10His&C-Myc
Target Protein Sequence MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDV
Expression Range 1-305aa
Protein Length Full Length
Mol. Weight 39.6 kDa
Research Area Cancer
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Transcription regulator involved in inner cell mass and embryonic stem (ES) cells proliferation and self-renewal. Imposes pluripotency on ES cells and prevents their differentiation towards extraembryonic endoderm and trophectoderm lineages. Blocks bone morphogenetic protein-induced mesoderm differentiation of ES cells by physically interacting with SMAD1 and interfering with the recruitment of coactivators to the active SMAD transcriptional complexes. Acts as a transcriptional activator or repressor. Binds optimally to the DNA consensus sequence 5'-TAAT[GT][GT]-3' or 5'-[CG][GA][CG]C[GC]ATTAN[GC]-3'. Binds to the POU5F1/OCT4 promoter. Able to autorepress its expression in differentiating (ES) cells: binds to its own promoter following interaction with ZNF281/ZFP281, leading to recruitment of the NuRD complex and subsequent repression of expression. When overexpressed, promotes cells to enter into S phase and proliferation.
Subcellular Location Nucleus.
Protein Families Nanog homeobox family
Database References

HGNC: 20857

OMIM: 607937

KEGG: hsa:79923

STRING: 9606.ENSP00000229307

UniGene: PMID: 29787607

  • A higher expression of the pluripotency factor NANOG. PMID: 29845283
  • The interaction of Nanog with the AR signaling axis might induce or contribute to Ovarian cancer stem cells regulation. In addition, androgen might promote stemness characteristics in ovarian cancer cells by activating the Nanog promoter PMID: 29716628
  • The results show that Nanog expression was related to HBsAg, differentiation, and TNM stage in hepatocellular carcinoma (HCC). Nanog may be an unfavorable prognostic biomarker for HCC. PMID: 29198990
  • NANOG might be a potential biomarker for early diagnosis of urothelial carcinoma of the bladder. PMID: 29279584
  • These results demonstrate that analysis of IHC expression patterns of MK and NANOG in pretreatment biopsy specimens during the work-up period can provide a more definitive prognosis prediction for each oral squamous cell carcinoma (OSCC) patient that can help clinicians to develop a more precise individual treatment modality. PMID: 29113102
  • Chicken egg-white extracts promote OCT4 and NANOG expression and telomeres growth in 293T cells. PMID: 28838341
  • Rectal tumor tissue OCT4 (p<0.001), SOX2 (p=0.003), and NANOG (p<0.001) expressions were higher than those in adjacent tissue. PMID: 29214774
  • Data show that lung adenocarcinoma SPC-A1 cell differentiated by a two-stage induction (TSI) method lost stem cell characteristics, including absent expression of OCT4 and Nanog. PMID: 27588392
  • our data suggest that 3D culture increases the expression of Nanog through the relaxation of actin cytoskeleton, which mediates reduced Suv39h1 and H3K9me3 levels. PMID: 28276635
  • results show that NANOG could reverse the effects of stem cell senescence and restore the myogenic differentiation potential of senescent MSCs. PMID: 28125933
  • MACC1-induced tumor progression in colorectal cancer acts, at least in part, via the newly discovered MACC1/Nanog/Oct4 axis. PMID: 26758557
  • RNAi-mediated silencing of NANOG in SKOV-3 reversed the expression of mesenchymal cell markers and restored expression of E-cadherin. Susceptibility to cisplatin increased in SKOV-3 cells on down-regulating NANOG and reversible results were obtained in Moody cells post-overexpression of NANOG. PMID: 27884977
  • NANOG enabled reactivation of the ROCK and Transforming Growth Factor (TGF)-beta pathways-both of which were impaired in senescent cells-leading to ACTIN polymerization, MRTF-A translocation into the nucleus and serum response factor (SRF)-dependent myogenic gene expression. PMID: 27350449
  • High NANOG expression is associated with brain neoplasms. PMID: 28933914
  • Super-enhancers at the Nanog locus differentially regulate neighboring pluripotency-associated genes, in particular, DPPA3. PMID: 27681417
  • our data reveal that SATB2 in alveolar bone mesenchymal stem cells (AB-BMSCs) associates with their age-related properties, and prevents AB-BMSCs senescence via maintaining Nanog expression. PMID: 27632702
  • High NANOG expression is associated with Multidrug Resistance in breast and cervical cancer. PMID: 28716899
  • miR-612 has a suppressive role on hepatocellular carcinoma cell stemness via Sp1/Nanog signaling pathway. PMID: 27685621
  • These data reveal an overexpression of NANOG and other markers of pluripotency and stemness in meningiomas. PMID: 28345785
  • The NANOG deficiency affected multiple genes, particularly, supressed drug-resistance via down-regulated ABCG2 in Eca109 cells, and caused G1 arrest by down-regulated cyclin D1 (CCND1) expression. PMID: 28601640
  • Endogenous Plastic Somatic (ePS) cells in a latent state, i.e. lacking SOX2, OCT3/4 and NANOG (SON) expression, in non-diseased breast specimens through immunohistochemical analysis of previously identified ePS-specific biomarkers (CD73(+), EpCAM(+) and CD90(-)). PMID: 27705752
  • Data suggest that C-terminal truncated hepatitis B virus X protein (HBx-DeltaC1) enhances liver cancer stem cell (CSC) properties through Stat3/Nanog cascade, and insight for the therapeutic intervention for hepatitis B virus (HBV)-related hepatocellular carcinoma (HCC). PMID: 28186991
  • Nanog directly repressed transcription of the miR-200c and miR-200b genes in colon cancer cells, inducing epithelial-mesenchymal transformation. PMID: 28163188
  • LGR5-expressing fraction of CD54+ cells represents gastric cancer CSCs, in which LGR5 is closely associated with stemness and EMT core genes PMID: 28033430
  • Data show that Nanog homebox (NANOG) but not sex-determining region Y-box2 (SOX2) and octamer-binding protein 4 (OCT4) expression was overexpressed in the endometrium of women with intrauterine adhesion (IUA). PMID: 28253866
  • The NANOG transcription was significantly upregulated by ETV4 overexpression. PMID: 28412366
  • Collectively, these findings demonstrate a novel role of YBX1 in maintaining the stemness of CSCs and metastasis, unveiling YBX1 as promising therapeutic target for NSCLC treatments. PMID: 28400280
  • the early response of pluripotency genes OCT4 and NANOG to the differentiation-inducing stimuli is mediated by dynamic changes in chromatin marks, while DNA methylation is acquired in the later stages of neurogenesis. PMID: 28601081
  • USP21 specifically regulates the Lys48-linked polyubiquitination and stability of NANOG PMID: 27956178
  • To our knowledge, this is the first report on lineage reprogramming of TILs using protein stem cell transcription factors delivered directly to the nucleus. PMID: 27084449
  • Nanog expression is a prognostic biomarkers for triple-negative breast cancer PMID: 27300169
  • Stat3 was correlated with NANOG-mediated EMT. PMID: 26801672
  • miR-760 was proved to be functional associated with NANOG via regulating its expression. PMID: 27133070
  • SIRT-1 and NANOG are high correlated biological markers for diagnosis and prognosis follow up in patients with adenocarcinoma. PMID: 27540973
  • renal cell carcinoma patients with low Nanog and Oct4 expressions in tumor tissues had significantly higher survival rates (p < 0.05). High Nanog and Oct4 expressions may be potential therapeutic targets. PMID: 26631537
  • ANOG was regulated by extracellular IGF signaling pathway via STAT3 phosphorylation in colorectal cancer (CRC). This coincides with that IGF receptor IGF-1R is often increasing expressed in malignant metastasis colon cancer. Taken together, our data define the crucial functions of IGF/STAT3/NANOG/Slug signaling axis in the progression of CRC PMID: 26840943
  • Nanog is a positive regulator of cervical cancer dedifferentiation. PMID: 26936116
  • Data show that long intergenic non-protein coding RNA ROR may act as a competitive endogenous RNAs (ceRNAs), effectively becoming a sink for microRBA miR-145, thereby activating the derepression of core transcription factors Nanog. PMID: 26636540
  • ALKBH5 overexpression decreased NANOG mRNA methylation, increased NANOG levels, and increased the percentage of BCSCs, phenocopying the effect of hypoxia PMID: 27001847
  • Expression levels of OCT4, SOX2, and NANOG were evaluated by immunohistochemistry with tissue microarray slides of 436 OSCC, 362 corresponding tumor-adjacent normal (CTAN) tissues, and 71 normal uvula epithelium tissues. PMID: 26211876
  • Nanog possesses important function in BCSC. PMID: 26339994
  • Our study provides new insight into the function of DPPA5 and NANOG regulation in human pluripotent stem cell . PMID: 26661329
  • the available data demonstrate that NANOG is strictly involved in the process of carcinogenesis and is a potential prognostic marker of malignant tumors. PMID: 26618281
  • the disruption of Nanog expression results in less proliferation, invasiveness, migration, more chemosensitivity and reversal of EMT in HepG2 cells, by which Nanog plays crucial roles in influencing the malignant phenotype of HepG2 cells. PMID: 26676719
  • The promoter activity of Nanog and Oct4 were upregulated, and beta-catenin was observed to bind to these promoters during H. pylori infection, while a Wnt/beta-catenin inhibitor suppressed promoter activity and binding. PMID: 26940070
  • ectopic expression of Oct-4 gene in hAFMSCs with high self-renewal ability could upregulate Nanog and Sox-2 gene expression PMID: 25385323
  • Nanog is an oncogene with multiple roles in promoting tumorigenesis and metastasis PMID: 26073077
  • The positive correlation among Oct-4, Nanog, and beta-catenin suggests their coordinated role in maintaining proliferation in oral carcinoma cells. PMID: 24700702
  • Oct3/4 and Nanog represent probable CSC markers in HNSCC, which contribute to the development of DNM in part by enhancing cell motility and invasiveness. PMID: 26483189
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed