Recombinant Human Homeobox Protein Nanog (NANOG) Protein (His)

Beta LifeScience SKU/CAT #: BLC-10317P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Homeobox Protein Nanog (NANOG) Protein (His)

Beta LifeScience SKU/CAT #: BLC-10317P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Homeobox Protein Nanog (NANOG) Protein (His) is produced by our Yeast expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb Q9H9S0
Target Symbol NANOG
Synonyms Embryonic stem cell specific homeobox protein (Nanog); ENK; FLJ12581; hNanog; Homeobox protein NANOG; Homeobox transcription factor Nanog; homeobox transcription factor Nanog-delta 48; NANOG; Nanog homeobox; NANOG_HUMAN
Species Homo sapiens (Human)
Expression System Yeast
Tag N-6His
Target Protein Sequence MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDV
Expression Range 1-305aa
Protein Length Full Length
Mol. Weight 36.6kDa
Research Area Cancer
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Transcription regulator involved in inner cell mass and embryonic stem (ES) cells proliferation and self-renewal. Imposes pluripotency on ES cells and prevents their differentiation towards extraembryonic endoderm and trophectoderm lineages. Blocks bone morphogenetic protein-induced mesoderm differentiation of ES cells by physically interacting with SMAD1 and interfering with the recruitment of coactivators to the active SMAD transcriptional complexes. Acts as a transcriptional activator or repressor. Binds optimally to the DNA consensus sequence 5'-TAAT[GT][GT]-3' or 5'-[CG][GA][CG]C[GC]ATTAN[GC]-3'. Binds to the POU5F1/OCT4 promoter. Able to autorepress its expression in differentiating (ES) cells: binds to its own promoter following interaction with ZNF281/ZFP281, leading to recruitment of the NuRD complex and subsequent repression of expression. When overexpressed, promotes cells to enter into S phase and proliferation.
Subcellular Location Nucleus.
Protein Families Nanog homeobox family
Database References
Tissue Specificity Expressed in testicular carcinoma and derived germ cell tumors (at protein level). Expressed in fetal gonads, ovary and testis. Also expressed in ovary teratocarcinoma cell line and testicular embryonic carcinoma. Not expressed in many somatic organs and

Gene Functions References

  1. The critical roles of NANOG and its pseudogene NANOGP8 in cancer progression leads the association of these genes with exosomes to be significant, and may allow for exosomal NANOG to function as a powerful diagnostic biomarker. Variations in NANOG/NANOGP8 gene sequences in exosomal DNA includes an insertion into the 3' UTR. PMID: 29787607
  2. A higher expression of the pluripotency factor NANOG. PMID: 29845283
  3. The interaction of Nanog with the AR signaling axis might induce or contribute to Ovarian cancer stem cells regulation. In addition, androgen might promote stemness characteristics in ovarian cancer cells by activating the Nanog promoter PMID: 29716628
  4. The results show that Nanog expression was related to HBsAg, differentiation, and TNM stage in hepatocellular carcinoma (HCC). Nanog may be an unfavorable prognostic biomarker for HCC. PMID: 29198990
  5. NANOG might be a potential biomarker for early diagnosis of urothelial carcinoma of the bladder. PMID: 29279584
  6. These results demonstrate that analysis of IHC expression patterns of MK and NANOG in pretreatment biopsy specimens during the work-up period can provide a more definitive prognosis prediction for each oral squamous cell carcinoma (OSCC) patient that can help clinicians to develop a more precise individual treatment modality. PMID: 29113102
  7. Chicken egg-white extracts promote OCT4 and NANOG expression and telomeres growth in 293T cells. PMID: 28838341
  8. Rectal tumor tissue OCT4 (p<0.001), SOX2 (p=0.003), and NANOG (p<0.001) expressions were higher than those in adjacent tissue. PMID: 29214774
  9. Data show that lung adenocarcinoma SPC-A1 cell differentiated by a two-stage induction (TSI) method lost stem cell characteristics, including absent expression of OCT4 and Nanog. PMID: 27588392
  10. our data suggest that 3D culture increases the expression of Nanog through the relaxation of actin cytoskeleton, which mediates reduced Suv39h1 and H3K9me3 levels. PMID: 28276635
  11. results show that NANOG could reverse the effects of stem cell senescence and restore the myogenic differentiation potential of senescent MSCs. PMID: 28125933
  12. MACC1-induced tumor progression in colorectal cancer acts, at least in part, via the newly discovered MACC1/Nanog/Oct4 axis. PMID: 26758557
  13. RNAi-mediated silencing of NANOG in SKOV-3 reversed the expression of mesenchymal cell markers and restored expression of E-cadherin. Susceptibility to cisplatin increased in SKOV-3 cells on down-regulating NANOG and reversible results were obtained in Moody cells post-overexpression of NANOG. PMID: 27884977
  14. NANOG enabled reactivation of the ROCK and Transforming Growth Factor (TGF)-beta pathways-both of which were impaired in senescent cells-leading to ACTIN polymerization, MRTF-A translocation into the nucleus and serum response factor (SRF)-dependent myogenic gene expression. PMID: 27350449
  15. High NANOG expression is associated with brain neoplasms. PMID: 28933914
  16. Super-enhancers at the Nanog locus differentially regulate neighboring pluripotency-associated genes, in particular, DPPA3. PMID: 27681417
  17. our data reveal that SATB2 in alveolar bone mesenchymal stem cells (AB-BMSCs) associates with their age-related properties, and prevents AB-BMSCs senescence via maintaining Nanog expression. PMID: 27632702
  18. High NANOG expression is associated with Multidrug Resistance in breast and cervical cancer. PMID: 28716899
  19. miR-612 has a suppressive role on hepatocellular carcinoma cell stemness via Sp1/Nanog signaling pathway. PMID: 27685621
  20. These data reveal an overexpression of NANOG and other markers of pluripotency and stemness in meningiomas. PMID: 28345785
  21. The NANOG deficiency affected multiple genes, particularly, supressed drug-resistance via down-regulated ABCG2 in Eca109 cells, and caused G1 arrest by down-regulated cyclin D1 (CCND1) expression. PMID: 28601640
  22. Endogenous Plastic Somatic (ePS) cells in a latent state, i.e. lacking SOX2, OCT3/4 and NANOG (SON) expression, in non-diseased breast specimens through immunohistochemical analysis of previously identified ePS-specific biomarkers (CD73(+), EpCAM(+) and CD90(-)). PMID: 27705752
  23. Data suggest that C-terminal truncated hepatitis B virus X protein (HBx-DeltaC1) enhances liver cancer stem cell (CSC) properties through Stat3/Nanog cascade, and insight for the therapeutic intervention for hepatitis B virus (HBV)-related hepatocellular carcinoma (HCC). PMID: 28186991
  24. Nanog directly repressed transcription of the miR-200c and miR-200b genes in colon cancer cells, inducing epithelial-mesenchymal transformation. PMID: 28163188
  25. LGR5-expressing fraction of CD54+ cells represents gastric cancer CSCs, in which LGR5 is closely associated with stemness and EMT core genes PMID: 28033430
  26. Data show that Nanog homebox (NANOG) but not sex-determining region Y-box2 (SOX2) and octamer-binding protein 4 (OCT4) expression was overexpressed in the endometrium of women with intrauterine adhesion (IUA). PMID: 28253866
  27. The NANOG transcription was significantly upregulated by ETV4 overexpression. PMID: 28412366
  28. Collectively, these findings demonstrate a novel role of YBX1 in maintaining the stemness of CSCs and metastasis, unveiling YBX1 as promising therapeutic target for NSCLC treatments. PMID: 28400280
  29. the early response of pluripotency genes OCT4 and NANOG to the differentiation-inducing stimuli is mediated by dynamic changes in chromatin marks, while DNA methylation is acquired in the later stages of neurogenesis. PMID: 28601081
  30. USP21 specifically regulates the Lys48-linked polyubiquitination and stability of NANOG PMID: 27956178
  31. To our knowledge, this is the first report on lineage reprogramming of TILs using protein stem cell transcription factors delivered directly to the nucleus. PMID: 27084449
  32. Nanog expression is a prognostic biomarkers for triple-negative breast cancer PMID: 27300169
  33. Stat3 was correlated with NANOG-mediated EMT. PMID: 26801672
  34. miR-760 was proved to be functional associated with NANOG via regulating its expression. PMID: 27133070
  35. SIRT-1 and NANOG are high correlated biological markers for diagnosis and prognosis follow up in patients with adenocarcinoma. PMID: 27540973
  36. renal cell carcinoma patients with low Nanog and Oct4 expressions in tumor tissues had significantly higher survival rates (p < 0.05). High Nanog and Oct4 expressions may be potential therapeutic targets. PMID: 26631537
  37. ANOG was regulated by extracellular IGF signaling pathway via STAT3 phosphorylation in colorectal cancer (CRC). This coincides with that IGF receptor IGF-1R is often increasing expressed in malignant metastasis colon cancer. Taken together, our data define the crucial functions of IGF/STAT3/NANOG/Slug signaling axis in the progression of CRC PMID: 26840943
  38. Nanog is a positive regulator of cervical cancer dedifferentiation. PMID: 26936116
  39. Data show that long intergenic non-protein coding RNA ROR may act as a competitive endogenous RNAs (ceRNAs), effectively becoming a sink for microRBA miR-145, thereby activating the derepression of core transcription factors Nanog. PMID: 26636540
  40. ALKBH5 overexpression decreased NANOG mRNA methylation, increased NANOG levels, and increased the percentage of BCSCs, phenocopying the effect of hypoxia PMID: 27001847
  41. Expression levels of OCT4, SOX2, and NANOG were evaluated by immunohistochemistry with tissue microarray slides of 436 OSCC, 362 corresponding tumor-adjacent normal (CTAN) tissues, and 71 normal uvula epithelium tissues. PMID: 26211876
  42. Nanog possesses important function in BCSC. PMID: 26339994
  43. Our study provides new insight into the function of DPPA5 and NANOG regulation in human pluripotent stem cell . PMID: 26661329
  44. the available data demonstrate that NANOG is strictly involved in the process of carcinogenesis and is a potential prognostic marker of malignant tumors. PMID: 26618281
  45. the disruption of Nanog expression results in less proliferation, invasiveness, migration, more chemosensitivity and reversal of EMT in HepG2 cells, by which Nanog plays crucial roles in influencing the malignant phenotype of HepG2 cells. PMID: 26676719
  46. The promoter activity of Nanog and Oct4 were upregulated, and beta-catenin was observed to bind to these promoters during H. pylori infection, while a Wnt/beta-catenin inhibitor suppressed promoter activity and binding. PMID: 26940070
  47. ectopic expression of Oct-4 gene in hAFMSCs with high self-renewal ability could upregulate Nanog and Sox-2 gene expression PMID: 25385323
  48. Nanog is an oncogene with multiple roles in promoting tumorigenesis and metastasis PMID: 26073077
  49. The positive correlation among Oct-4, Nanog, and beta-catenin suggests their coordinated role in maintaining proliferation in oral carcinoma cells. PMID: 24700702
  50. Oct3/4 and Nanog represent probable CSC markers in HNSCC, which contribute to the development of DNM in part by enhancing cell motility and invasiveness. PMID: 26483189

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed