Recombinant Human Homeobox Protein Mox-1 (MEOX1) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-09227P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Homeobox Protein Mox-1 (MEOX1) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-09227P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Homeobox Protein Mox-1 (MEOX1) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P50221 |
| Target Symbol | MEOX1 |
| Synonyms | Homeobox protein MOX-1; MEOX1; MEOX1_HUMAN; Mesenchyme homeo box 1; Mesenchyme homeobox 1; MOX 1; MOX1 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | MDPAASSCMRSLQPPAPVWGCLRNPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYPDFSASCLAATPHSLPQEEHIFTEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGSTANETEKKSSRRRKESSDNQENRGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPSSE |
| Expression Range | 1-254aa |
| Protein Length | Full Length |
| Mol. Weight | 55.0kDa |
| Research Area | Cell Biology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Mesodermal transcription factor that plays a key role in somitogenesis and is specifically required for sclerotome development. Required for maintenance of the sclerotome polarity and formation of the cranio-cervical joints. Binds specifically to the promoter of target genes and regulates their expression. Activates expression of NKX3-2 in the sclerotome. Activates expression of CDKN1A and CDKN2A in endothelial cells, acting as a regulator of vascular cell proliferation. While it activates CDKN1A in a DNA-dependent manner, it activates CDKN2A in a DNA-independent manner. Required for hematopoietic stem cell (HSCs) induction via its role in somitogenesis: specification of HSCs occurs via the deployment of a specific endothelial precursor population, which arises within a sub-compartment of the somite named endotome. |
| Subcellular Location | Nucleus. Cytoplasm. |
| Database References | HGNC: 7013 OMIM: 214300 KEGG: hsa:4222 STRING: 9606.ENSP00000321684 UniGene: PMID: 27285982 |
