Recombinant Human Homeobox Protein Meis1 (MEIS1) Protein (His)

Name: Recombinant Human Homeobox Protein Meis1 (MEIS1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-04731P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Homeobox Protein Meis1 (MEIS1) Protein (His) is produced by our Yeast expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	O00470
Target Symbol	MEIS1
Synonyms	Homeo box protein Meis1; Homeobox protein Meis1; Leukemogenic homolog protein; MEIS 1; Meis homeo box 1; Meis homeobox 1; Meis1; Meis1 mouse homolog; Meis1 myeloid ecotropic viral integration site 1 homolog; Meis1 myeloid ecotropic viral integration site 1 homolog mouse; MEIS1 protein; MEIS1_HUMAN; MGC43380; Myeloid ecotropic viral integration site 1 homolog ; WUGSC:H NH0444B04.1
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	KMPIDLVIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVN
Expression Range	180-320aa
Protein Length	Partial
Mol. Weight	17.4 kDa
Research Area	Epigenetics And Nuclear Signaling
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Acts as a transcriptional regulator of PAX6. Acts as a transcriptional activator of PF4 in complex with PBX1 or PBX2. Required for hematopoiesis, megakaryocyte lineage development and vascular patterning. May function as a cofactor for HOXA7 and HOXA9 in the induction of myeloid leukemias.
Subcellular Location	Nucleus.
Protein Families	TALE/MEIS homeobox family
Database References	HGNC: 7000 OMIM: 601739 KEGG: hsa:4211 STRING: 9606.ENSP00000272369 UniGene: PMID: 28462489 By investigating the role of MEIS1 in ccRCC cells' survival, proliferation, anchorage-independent growth, cell cycle progress, apoptosis and metastasis, in the present work, we propose that MEIS1 may play an important role in clear cell renal cell carcinoma (ccRCC) development. PMID: 28270206 Conclusions MEIS1 variants were associated with an increased risk of RLS in migraine patients. It is possible that an imbalance in iron homeostasis and the dopaminergic system may represent a link between RLS incidence and migraines. PMID: 26643377 We speculate that ACTR2 and MEIS1 might respectively play a role in the pathogenesis of the observed deafness and cardiomyopathy...the patient carrying a 2p14p15 deletion including OTX1 had normal kidneys and genitalia, thus confirming that OTX1 haploinsufficiency is not invariably associated with genitourinary defects. PMID: 28599093 results reveal that MEIS1, through induction of SYTL1, promotes leukemogenesis and supports leukemic cell homing and engraftment, facilitating interactions between leukemic cells and bone marrow stroma. PMID: 27018596 Meis1 regulates expression and activation of Syk in Hoxa9-driven leukemia. PMID: 28399410 Here we present the result of a 4-stage genome-wide association study composed of 5,953 adolescent idiopathic scoliosis patients and 8,137 controls. Overall, we identified three novel susceptible loci including rs7593846 at 2p14 near MEIS1 , rs7633294 at 3p14.1 near MAGI1 and rs9810566 at 3q26.2 near TNIK PMID: 28334814 Results show that Meis1 may have a positive feedback with Msi1 during the esophageal squamous cell carcinoma progression. PMID: 27142513 Meis1 functions as an important regulator during the progression of acute myeloid leukemia. PMID: 28054140 MEIS1 drivesMalignant peripheral nerve sheath tumors cell growth via the transcription factor ID1, thereby suppressing expression of the cell cycle inhibitor p27(Kip) and maintaining cell survival. PMID: 27333032 it was observed that ER stimulated gene expression by interacting with MEIS1 and FOXP3, and ER inhibited gene expression by interacting with THRB and GRHL1. PMID: 27035558 this is the first report on the MEIS1 gene in esophageal squamous cell carcinoma PMID: 26314854 Infant patients with acute lymphoblastic leukemia expressing low levels of MEIS1 had a superior outcome over patients expressing high levels of the protein. PMID: 26681762 Our findings confirm an association between the BTBD9, MEIS1, and MAP2K5/SKOR1 SNPs and periodic limb movements of sleep in an elderly cohort. PMID: 26498236 It was observed that RE-IIBP induces MEIS1-mediated apoptosis, which was dependent on H2BK120 ubiquitination by RNF20. PMID: 26206755 Studies implicate PBX3/MEIS1 interaction as a driver of cell transformation and leukemogenesis, and that this axis may play a critical role in the regulation of the core transcriptional programs activated in MLL-rearranged and HOX-overexpressing AML. PMID: 26747896 The NK AML patients with NPM1 mutations exhibited elevated HOXA4 methylation and expression levels of HOXA5 and MEIS1 compared with the NPM1 wildtype patients. PMID: 25585874 Pbx3 contributes to Hoxa9 leukemogenesis through stabilization of the Meis1 protein. PMID: 26130510 HOXA9 and MEIS1 overexpression are inversely correlated with relapse and overall survival, so the genes could become useful predictive markers of the clinical course of pediatric acute leukemias. PMID: 26059450 Data indicate that Meis homeobox 1 (MEIS1) knockdown by lentiviral-shRNA significantly inhibited the growth in leukemia cell lines. PMID: 25740828 MEIS1 expression induces lineage commitment towards a megakaryocyte-erythroid progenitor cell fate in common myeloid progenitor cells through activation of genes that define a megakaryocyte-erythroid-specific gene expression program. PMID: 25107888 Periodic leg movements during sleep are associated with polymorphisms in BTBD9, TOX3/BC034767, MEIS1, MAP2K5/SKOR1, and PTPRD PMID: 25142570 MEIS1 is likely a key mediator between sex steroid and genes for uterine receptivity. Diminished endometrium MEIS1 expression may contribute to implantation failure in endometriosis. PMID: 24985084 statistically significantly lower expression of miR-204 in all nephroblastomas investigated might point to an involvement of miR-204 in the regulation of MEIS1 in nephroblastomas PMID: 24617557 data link MEIS1 loss of function to the etiopathology of RLS, highlight how combined sequencing and systematic functional annotation of rare variation at GWAS loci can detect risk burden PMID: 24995868 BRAF p.V600E colon tumors showed significant MEIS1 promoter methylation, which was associated with decreased MEIS1 gene expression. PMID: 24244575 MEIS1 in hematopoiesis and contributes to its aberrant expression in acute leukemia PMID: 24022755 Hoxa7, Hoxa9 and Hox cofactor Meis1 were identified as AP-2alpha target genes, which are involved in myeloid leukemogenesis. PMID: 23660297 [review] It is possible that Meis1 contributes to the quiescent state of adult cardiomyocytes by regulating redox homeostasis. PMID: 23868827 Data indicate that dynamin 3 (DNM3) harbors MEIS1 binding sites and is associated with differences in mean platelet volume (MPV). PMID: 22972982 up-regulation of MEIS1 is important for sustaining proliferation of leukemic cells and that down-regulation of MEIS1 PMID: 22185299 findings show that HOXA9 and MEIS1 are direct targets of miRNA-196b, a microRNA located adjacent to and co-expressed with HOXA9, in MLL-rearranged leukaemic cells PMID: 22353710 the cellular context in which HOX/MEIS1 is overexpressed appears to be very important, and other relevant genes are most likely required as well to maintain the expanding capacity of the CD34thorn NPMcthorn acute myeloid leukemia cells PMID: 21986840 Data show that MEIS1D, a Meis1 isoform, is expressed in colon. PMID: 21858198 Variants in MEIS1, BTBD9, and MAP2K5/SKOR1 confer a significant risk of restless legs syndrome in a United States population. PMID: 21925394 In the German sample, variants in MEIS1 and BTBD9 were associated with Restless legs syndrome in end stage renal disease PMID: 21572129 These findings indicate that Meis1 works as a transcription factor for mitochondrial genes in pancreatic cancer cells. PMID: 21703237 A link is established between the restless legs syndrome-associated MEIS1 gene and iron metabolism. PMID: 21710629 Several targets of MLL fusions, MEIS1, HOXA7, HOXA9, and HOXA10 are functionally related and have been implicated in leukemias. Each of the four genes was knocked down separately in the precursor B-cell leukemic line RS4;11 expressing MLL-AF4. PMID: 21518888 Screening of the coding regions of MEIS1 in patients with RLS revealed 3 novel variants. PMID: 21422461 ETS transcription factor ELF1 is an important positive regulator of MEIS1 expression PMID: 20600580 GSK-3 maintains the MLL leukemia stem cell transcriptional program by promoting the conditional association of CREB and its coactivators TORC and CBP with homedomain protein MEIS1, which in turn facilitates HOX-mediated transcription and transformation. PMID: 20541704 co-operation between TLX1 and MEIS proteins may have a significant role in T-cell leukemogenesis. PMID: 19559479 Data demonstrated that overexpressed PBX1 and MEIS1 increased endogenous SOX3 protein expression in both uninduced and RA-induced NT2/D1 cells. PMID: 19799567 these studies demonstrate that the homeodomain proteins, MEIS1, PBX1B, and PBX2, play an important role in megakaryocytic gene expression PMID: 12609849 Hoxa9 and Hoxa7 as well as the Hox coregulators Meis1 and Pbx3 among the targets upregulated by MLL-ENL-ERtm in conditionally transformed cells PMID: 14701735 Data report novel nucleoporin 98 fusions with homeobox (HOX)A10, HOXB3 and HOXB4, and describe the results of coexpression of these proteins with the Hox cofactor Meis1 in leukemic induction. PMID: 14966272 found a constant downregulation of the Meis 1 gene mRNA in AML1-ETO acute myeloid leukemias and in those cases harboring in frame mutations in the bZIP domain of CEBPalpha PMID: 15103390 suggest that MLL aberrations may regulate MEIS1 and HOXA9 gene expression in ALL-derived cell lines, while AML-derived cell lines express these genes independently of the MLL status PMID: 15160920 advantage to Meis1-HoxA9 coexpressing cells in vivo, leading to leukemogenesis. PMID: 15479723

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Homeobox Protein Meis1 (MEIS1) Protein (His)

Recombinant Human Homeobox Protein Meis1 (MEIS1) Protein (His)

Product Overview

Target Details

FAQs