Recombinant Human Hla Class Ii Histocompatibility Antigen Gamma Chain (CD74) Protein (His-Myc)

Name: Recombinant Human Hla Class Ii Histocompatibility Antigen Gamma Chain (CD74) Protein (His-Myc)
Brand: Beta LifeScience
SKU: BLC-07590P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Car-nk targets proteins, Cluster of differentiation (cd) proteins, Featured cd protein molecules, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Hla Class Ii Histocompatibility Antigen Gamma Chain (CD74) Protein (His-Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P04233
Target Symbol	CD74
Synonyms	CD74; DHLAG; HLA class II histocompatibility antigen gamma chain; HLA-DR antigens-associated invariant chain; Ia antigen-associated invariant chain; Ii; CD antigen CD74
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	C-6His-Myc
Target Protein Sequence	QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKC
Expression Range	73-232aa
Protein Length	Partial
Mol. Weight	21.0 kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to the endosomal/lysosomal system where the antigen processing and binding of antigenic peptides to MHC class II takes place. Serves as cell surface receptor for the cytokine MIF.; Binds to the peptide-binding site of MHC class II alpha/beta heterodimers forming an alpha-beta-CLIP complex, thereby preventing the loading of antigenic peptides to the MHC class II complex until its release by HLA-DM in the endosome.; Stabilizes the conformation of mature CTSL by binding to its active site and serving as a chaperone to help maintain a pool of mature enzyme in endocytic compartments and extracellular space of antigen-presenting cells (APCs). Has antiviral activity by stymieing the endosomal entry of Ebola virus and coronaviruses, including SARS-CoV-2. Disrupts cathepsin-mediated Ebola virus glycoprotein processing, which prevents viral fusion and entry. This antiviral activity is specific to p41 isoform.
Subcellular Location	Cell membrane; Single-pass type II membrane protein. Endoplasmic reticulum membrane. Golgi apparatus, trans-Golgi network. Endosome. Lysosome. Note=Transits through a number of intracellular compartments in the endocytic pathway. It can either undergo proteolysis or reach the cell membrane.; [Isoform p41]: Late endosome. Lysosome.
Database References	HGNC: 1697 OMIM: 142790 KEGG: hsa:972 STRING: 9606.ENSP00000009530 UniGene: PMID: 28923927 These findings predict the binding mode of Hu-MIF-1 and orthologs with CD74. PMID: 28513076 results suggest that two immune biomarkers, CD74 and IL10, could be relevant tools for the identification of Intensive care unit-acquired infections risk in Intensive care unit patients. PMID: 28477143 Increased CD74 expression levels predicted worse stroke severity and outcomes in subjects with ischemic stroke. PMID: 27884769 The data validate CD74 as a useful prognostic tumor cell protein marker associated with favorable recurrence-free survival and overall survival in stage III melanoma. PMID: 26783288 These results have implications for the manner in which D-DT and MIF compete with each other for binding to the CD74 receptor and for the relative potency of DRa1-MOG-35-55 and RTL1000 for competitive inhibition of D-DT and MIF binding and activation through CD74. PMID: 27573366 CLIP expression and activated gamma-delta T cells are responsible for the development of preeclampsia. PMID: 28642294 these observations are consistent with the view that CD74 expression in tumor cells promotes the intratumoral immune response and is associated with a better prognosis in basal-like breast cancer PMID: 27058619 MIF-CD74 signaling inhibits interferon (IFN)-gamma secretion in microglia through phosphorylation of microglial ERK1/2 (extracellular signal-regulated protein kinases 1 and 2). The inhibition of MIF signaling or its receptor CD74 promotes IFN-gamma release and amplifies tumor death either through pharmacological inhibition or through siRNA-mediated knockdown. PMID: 27157615 High CD74 expression is associated with colorectal cancer. PMID: 27599658 the roles of CD74 and MIF in the immune surveillance escape process PMID: 26866879 CD74 downregulation in placental macrophages is present in preeclampsia. PMID: 27199465 CD74 was increased in burn patients. PMID: 27209369 predicted binding of one CD74 trimer to a single RTL1000 antagonist utilized the same two 5 residue determinants PMID: 26851955 an inverse correlation with the tumor size for stromal MIF and a positive correlation with the triple receptor negative tumor status for stromal CD74 seem to be showed PMID: 26412712 Studies indicate that the invariant chain (CD74) is critical for antigen presentation. PMID: 27033518 FOXP1 represents a novel regulator of genes targeted by the class II MHC transactivator CIITA and CD74. PMID: 26500140 Interferon gamma promotes melanoma cell survival regulating CD74-MIF interaction. PMID: 26039541 The results of this stusy suggested that the CD74 represents a positive prognostic marker most probably because of its association with an M1-polarized immune milieu in high-grade gliomas. PMID: 25175718 Invariant chain is a new chaperone for TLR7 in B cells. (Review) PMID: 26198699 CD74 expression and its therapeutic potential in thyroid carcinoma PMID: 25600560 Specific targeting of the CD74 on the lymphoma cell surface will sensitize CD74-expressing cancer cells to Fas-mediated apoptosis. PMID: 25304249 A conserved WW domain-like motif regulates CD74 antigen-dependent cell-surface transport of the NKG2D ligand ULBP2. PMID: 25983110 these results demonstrate that the subunit stoichiometry of oligomeric Ii/MHCII complexes is influenced by p35. PMID: 24638068 Findings showed an increased extent of MIF expression in cancer cells and in stromal fibroblasts of Breast Cancer tumor, in contrast to a less uniform increase of CD74 expression. PMID: 24939415 In human B cells, SPPL2a is indispensable for turnover of CD74 N-terminal fragment. PMID: 25035924 Results show that CD74-NRG1 gene fusions are activating genomic alterations in invasive mucinous lung adenocarcinomas. PMID: 24469108 In TPA-induced skin inflammation, MIF is released from damaged keratinocytes and then triggers the chemotaxis of CD74(+)CXCR2(+) NKT cells for IFN-gamma production. PMID: 25172501 Data show that clear cell renal cell carcinoma (ccRCC) tissue and malignant cell lines expressed higher levels of CD74 and hypoxia inducible factor 1alpha (HIF-1alpha) than adjacent normal renal tissue and normal cell HK-2. PMID: 23273913 Polymorphisms in CD74 is associated with hematologic toxicity in patients with non-small-cell lung cancer after platinum-based chemotherapy. PMID: 24220096 MIF/CD74 pathway may represent a crucial target for treating disc degeneration since inhibiting the function of MIF with its antagonist ISO-1 can reduce MIF-induced inflammation and exert potent therapeutic effects. PMID: 24569872 demonstrate that CLIP expression on leukemia-associated phenotype (LAP)-positive cells during follow-up is significantly correlated with a shortened relapse-free survival PMID: 24731748 High CD74 expression is associated with head and neck squamous cell carcinomas. PMID: 24663824 High expression of CD74 is an independent prognostic factor for prolonged overall survival in mesothelioma patients PMID: 24594996 These results demonstrate natural antagonist activity of DRalpha1 for macrophage migration inhibitory factor PMID: 24683185 Recombinant vaccinia virus vaccines encoding CD74 may be useful tools to improve CD4 T-cell responses to viral and tumour antigens. PMID: 24205828 when CD74 is overexpressed in human cancer and noncancerous epithelial cells, it interacts and interferes with the function of Scribble PMID: 23730214 Evaluated expression of CD74 in chronic lymphocytic leukemia patients. CD74 expression was significantly higher in CLL group than in controls. There was positive correlation between CD74 and ZAP70 expression. PMID: 23572149 Our data do not replicate prior reports of LN-2 as a sensitive and specific marker for undifferentiated pleomorphic sarcoma PMID: 23000905 CD74 antigen expression is increased in high grade, invasive urothelial bladder cancer. PMID: 22905972 Ii regulates the repertoire of tumor peptides presented by major histocompatibility complex class II+ breast cancer cells. PMID: 22942358 Data show that human Iip35 isoform (CD74 antigen) is expressed in mouse antigen presenting cells. PMID: 22689013 Data indicate that 25 +/- 1.3% of CD74 and 17 +/- 0.3% of HLA-DR are colocalized. PMID: 22889831 a novel regulatory mechanism governing cell migration during intervertebral disc degeneration PMID: 22952837 High Cd74 expression is associated with lymph node metastasis and triple-negative breast cancer. PMID: 22935920 Hepatitis C virus-mediated inhibition of cathepsin S increases invariant-chain expression on hepatocyte surface. PMID: 22761382 Expression of CD74-ROS in noninvasive NSCLC cell lines readily conferred invasive properties that paralleled the acquisition of E-Syt1 phosphorylation. PMID: 22659450 Stat1 and CD74 overexpression is co-dependent and linked to increased invasion and lymph node metastasis in triple-negative breast cancer. PMID: 22178447 Upregulation of MIF, CD74 and TLR4 are associated with increasing clinical stage and provide an opportunity as novel gastric cancer chemoprevention and/or treatment strategy. PMID: 22611320 This is the first study reporting that Ii chain up-regulation occurs on naturally infected antigen presenting cells obtained directly from HIV(+) subjects. PMID: 21945129

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.