Recombinant Human Hla Class I Histocompatibility Antigen, Alpha Chain E (HLA-E) Protein (His&Myc)

Name: Recombinant Human Hla Class I Histocompatibility Antigen, Alpha Chain E (HLA-E) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-08591P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Hla Class I Histocompatibility Antigen, Alpha Chain E (HLA-E) Protein (His&Myc) is produced by our Baculovirus expression system. This is a extracellular protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P13747
Target Symbol	HLA-E
Synonyms	HLA-E; HLA-6.2; HLAEHLA class I histocompatibility antigen; alpha chain E; MHC class I antigen E) [Cleaved into: Soluble HLA class I histocompatibility antigen; alpha chain E; sHLA-E)]
Species	Homo sapiens (Human)
Expression System	Baculovirus
Tag	N-10His&C-Myc
Target Protein Sequence	GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPI
Expression Range	22-305aa
Protein Length	Extracellular Domain
Mol. Weight	36.7 kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Non-classical major histocompatibility class Ib molecule involved in immune self-nonself discrimination. In complex with B2M/beta-2-microglobulin binds nonamer self-peptides derived from the signal sequence of classical MHC class Ia molecules (VL9 peptides). Peptide-bound HLA-E-B2M heterotrimeric complex primarily functions as a ligand for natural killer (NK) cell inhibitory receptor KLRD1-KLRC1, enabling NK cells to monitor the expression of other MHC class I molecules in healthy cells and to tolerate self. Upon cellular stress, preferentially binds signal sequence-derived peptides from stress-induced chaperones and is no longer recognized by NK cell inhibitory receptor KLRD1-KLRC1, resulting in impaired protection from NK cells. Binds signal sequence-derived peptides from non-classical MHC class Ib HLA-G molecules and acts as a ligand for NK cell activating receptor KLRD1-KLRC2, likely playing a role in the generation and effector functions of adaptive NK cells and in maternal-fetal tolerance during pregnancy. Besides self-peptides, can also bind and present pathogen-derived peptides conformationally similar to VL9 peptides to alpha-beta T cell receptor (TCR) on unconventional CD8+ cytotoxic T cells, ultimately triggering antimicrobial immune response.; (Microbial infection) Viruses like human cytomegalovirus have evolved an escape mechanism whereby virus-induced down-regulation of host MHC class I molecules is coupled to the binding of viral peptides to HLA-E, restoring HLA-E expression and inducing HLA-E-dependent NK cell immune tolerance to infected cells.; (Microbial infection) May bind HIV-1 gag/Capsid protein p24-derived peptide (AISPRTLNA) on infected cells and may inhibit NK cell cytotoxicity, a mechanism that allows HIV-1 to escape immune recognition.; (Microbial infection) Upon SARS-CoV-2 infection, may contribute to functional exhaustion of cytotoxic NK cells and CD8-positive T cells. Binds SARS-CoV-2 S/Spike protein S1-derived peptide (LQPRTFLL) expressed on the surface of lung epithelial cells, inducing NK cell exhaustion and dampening antiviral immune surveillance.
Subcellular Location	Cell membrane; Single-pass type I membrane protein. Golgi apparatus membrane.; [Soluble HLA class I histocompatibility antigen, alpha chain E]: Secreted.
Protein Families	MHC class I family
Database References	HGNC: 4962 OMIM: 143010 KEGG: hsa:3133 STRING: 9606.ENSP00000365817 UniGene: PMID: 28972140 It indicates that HLA-E expression may have an immunomodulatory effect and a possible role in the severity of liver disease in chronic hepatitis C. PMID: 29951556 HLA-E is highly represented in ovarian carcinoma suggesting a potential association with progressive disease mechanism PMID: 29499226 Soluble HLA-E level is useful as a biomarker of disease activity and course in Takayasu arteritis patients. rs1264457 polymorphism is neither associated with susceptibility nor did it influence sHLA-E levels in TA. PMID: 28425192 The frequency of the HLA-E0101/0103X genotype in male patients with Pemphigus Vulgaris was found to be significantly higher than in men in the control group (P=0.023). PMID: 29252170 These data suggest that HLA-E overexpression frequently occurs in renal cell carcinoma and correlates with reduced immunogenicity PMID: 27589686 HLA-E restricted CD8+ T cells may represent an important subset of pTregs, suppressing previously activated target cells. PMID: 24144875 No specific HLA-G and HLA-E haplotypes were significantly associated with increased risk of developing severe preeclampsia/eclampsia. PMID: 27596021 Our findings provide evidence that during renal allograft rejection HLA-E along with high numbers of mismatched HLA-class I leader peptides might represent additional targets for immune-activating responses. PMID: 27871782 The results suggest that HLA-E allelic variants may play a role in the modulation of immune responses in the context of the inability of natural conception and establishment of a viable pregnancy. PMID: 27714943 The prognostic benefit of natural killer cells, but not T-cells, is influenced by HLA-E expression in endometrial cancer. PMID: 29059634 This data reinforces the presence of only two main full-length HLA-E molecules encoded by the many HLA-E alleles detected in our population sample. In addition, this data does indicate that the distal HLA-E promoter is by far the most variable segment. PMID: 28946074 HLA-E alleles and sHLA-E levels may represent novel biomarkers for early disease progression in patients with chronic lymphocytic leukemia PMID: 27859015 In insulitic islets from living patients with recent-onset T1D, most of the overexpressed ISGs, including GBP1, TLR3, OAS1, EIF2AK2, HLA-E, IFI6, and STAT1, showed higher expression in the islet core compared with the peri-islet area containing the surrounding immune cells PMID: 27422384 soluble HLA-Ib molecules HLA-G and HLA-E are present in BM plasma samples in physiological and pathological conditions, and their concentration correlated with stage disease in NB patients. PMID: 27610393 this study shows the high expression of HLA-E in actinic chelitis and in lip squamous cell carcinoma, which reflects the capacity that these pathologies have for evasion and progression PMID: 26723902 Our study reveals that HLA-E polymorphism is associated with nasopharyngeal cancer. PMID: 26896927 High expression of HLA-E is associated with non-small cell lung carcinoma. PMID: 26658106 The positive correlation has been found between the HLA-E01:01/01:03 A>G polymorphism, plasma HLA-E level, and advanced fibrosis stages in chronic hepatitis B patients. PMID: 26956431 the promoter region of the HLA-E gene presents few and rare variable sites in Brazilian population sample. PMID: 26596885 HLA-E regulates NKG2C+ natural killer cell function through presentation of a restricted peptide repertoire PMID: 26382247 HLA-E is capable of presenting a highly conserved peptide from HIV-1 capsid (AISPRTLNA) that is not recognized by NKG2A/CD94. PMID: 26828202 over-expression of HLA-E is associated with melanoma PMID: 26090591 Peptide-induced HLA-E expression in human PBMCs is dependent on peptide sequence and the HLA-E genotype. PMID: 25735891 this study suggests that minor histocompatibility antigens presented by HLA-E can represent an additional risk factor following lung transplantation. PMID: 26302084 These results indicate that E01:01 is a novel protective genetic factor in EBV-associated cHL and support a role for HLA-E recognition on the control of EBV infection and lymphomagenesis. PMID: 26261988 HLA-E molecules traffic differently from the HLA-class I molecules and can play a fundamental role in the protection against intracellular pathogens and susceptibility to several diseases. PMID: 26310830 Functional differences and the immunological impact of HLA-E allelic variant Arg107Gly PMID: 26552660 increased risk of recurrent miscarriage in mothers carrying HLA-E01:01 allele; meta-analysis PMID: 25700963 The results derived from this study imply that HLA-E polymorphisms may influence RA susceptibility and affect clinical outcome of anti-TNF therapy in female RA patients. PMID: 26307125 genetic polymorphism is not associated with nasopharyngeal carcinoma in China PMID: 25636564 genetic polymorphism does not affect treatment outcome following allogeneic hematopoietic stem cell transplantation in Egyptian patients PMID: 25543014 Monoclonal antibodies to HLA-E bind epitopes carried by unfolded beta2 m-free heavy chains. PMID: 25982269 We identified that the HLA-E and HLA-F in gastric cancer independently affected clinical factors, including postoperative outcome PMID: 25862890 HLA-E gene polymorphisms are associated with the development of breast cancer in women of Han polulation. PMID: 25854574 HLA-E0103 allele is associated with susceptibility to serous ovarian cancer in a Chinese Han population. PMID: 25711417 Review of the impact of human leukocyte antigen molecules E, F, and G on the outcome of transplantation. PMID: 25420801 IL-12-producing monocytes and HLA-E control HCMV-driven NKG2C+ NK cell expansion. PMID: 25384219 novel insights in the mechanism via which HLA-E expression levels are controlled and how the cellular immune response in transplantation and cancer is influenced by HLA-E. PMID: 25413103 Results show that HLA-E and KIR2DL4 demonstrate evidence of positive selection between human, chimpanzee and gorilla suggesting a main role for immunological adaptations linked to embryo deep invasion of the maternal endometrium during pregnancy. PMID: 25451741 Studies suggest that HLA class I molecule HLA-E to be a ligand for the innate and adaptive immune system. PMID: 25401109 Sera from early-onset, severely preeclamptic women directly modulate HLA-E expression in the EA.hy296 endothelial cell line. PMID: 24837231 Findings indicate that HLA-E up-regulation in 3D-cultured cells may result in enhanced tumor resistance to NK cell-mediated immune response. PMID: 24742303 The expression levels of HLA-G or HLA-E alone and the combined expression of both molecules were all statistically correlated with the overall survival of colorectal cancer patients. PMID: 25461612 Transgenic hCD46/HLA-E expression reduced humoral xenoresponses since all were downregulated during ex vivo xenoperfusion of hCD46/HLA-E double transgenic pig forelimbs with human blood. PMID: 24635052 IL-27 driven upregulation of surface HLA-E expression on monocytes inhibits IFN-gamma release by autologous NK cells. PMID: 24741633 NKG2C receptor deletion and a functional polymorphism in its ligand HLA-E may play a role in psoriasis susceptibility PMID: 24079744 surface HLA-E was higher on melanoma cells than on melanocytes and protected the former (6/6 cell lines) from lysis by natural killer (NK) cells, functionally counteracting co-expressed triggering ligands. PMID: 24011128 These results indicate that generating transgenic HLA-E pigs might protect porcine grafts from, not only NK cytotoxicity, but also macrophage-mediated cytotoxicity. PMID: 23994719 Data suggest that the cell-surface HLA class I molecules HLA-E, HLA-C, and HLA-G co-localize with each other on trophoblast cell membranes and have the potential to form preferential heterotypic associations that may be modulated by progesterone. PMID: 24006284

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.