Recombinant Human Histone H3.1 (HIST1H3A) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-11133P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Histone H3.1 (HIST1H3A) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-11133P
Collections: High-quality recombinant proteins, Other recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Histone H3.1 (HIST1H3A) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P68431 |
Target Symbol | HIST1H3A |
Synonyms | H3 histone family member E pseudogene; H3 histone family; member A; H3/A; H31_HUMAN; H3F3; H3FA; Hist1h3a ; HIST1H3B; HIST1H3C; HIST1H3D; HIST1H3E; HIST1H3F; HIST1H3G; HIST1H3H; HIST1H3I; HIST1H3J; HIST3H3; histone 1; H3a ; Histone cluster 1; H3a; Histone H3 3 pseudogene; Histone H3.1; Histone H3/a; Histone H3/b; Histone H3/c; Histone H3/d; Histone H3/f; Histone H3/h; Histone H3/i; Histone H3/j; Histone H3/k; Histone H3/l |
Species | Homo sapiens (human) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER |
Expression Range | 2-135aa |
Protein Length | Partial |
Mol. Weight | 19.3 kDa |
Research Area | Epigenetics And Nuclear Signaling |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. |
Subcellular Location | Nucleus. Chromosome. |
Protein Families | Histone H3 family |
Database References | HGNC: 4766 OMIM: 137800 KEGG: hsa:8350 STRING: 9606.ENSP00000444823 UniGene: PMID: 28300060 |