Recombinant Human Histone Deacetylase 6 (HDAC6) Protein (His-SUMO)

Name: Recombinant Human Histone Deacetylase 6 (HDAC6) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-02566P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Histone Deacetylase 6 (HDAC6) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q9UBN7
Target Symbol	HDAC6
Synonyms	CPBHM; FLJ16239; HD 6; HD6; HDAC 6; HDAC6; HDAC6_HUMAN; Histone deacetylase 6 (HD6); Histone deacetylase 6; JM 21; JM21; KIAA0901; OTTHUMP00000032398; OTTHUMP00000197663; PPP1R90; Protein phosphatase 1 regulatory subunit 90
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLGQAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLIQEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNSYSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQKHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQGQGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATPAGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSAQASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSRTGLVYDQN
Expression Range	1-488aa
Protein Length	Partial
Mol. Weight	70.1 kDa
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. In addition to histones, deacetylates other proteins: plays a central role in microtubule-dependent cell motility by mediating deacetylation of tubulin. Promotes deacetylation of CTTN, leading to actin polymerization, promotion of autophagosome-lysosome fusion and completion of autophagy. Involved in the MTA1-mediated epigenetic regulation of ESR1 expression in breast cancer. In addition to its protein deacetylase activity, plays a key role in the degradation of misfolded proteins: when misfolded proteins are too abundant to be degraded by the chaperone refolding system and the ubiquitin-proteasome, mediates the transport of misfolded proteins to a cytoplasmic juxtanuclear structure called aggresome. Probably acts as an adapter that recognizes polyubiquitinated misfolded proteins and target them to the aggresome, facilitating their clearance by autophagy.
Subcellular Location	Cytoplasm. Cytoplasm, cytoskeleton. Nucleus. Perikaryon. Cell projection, dendrite. Cell projection, axon.
Protein Families	Histone deacetylase family, HD type 2 subfamily
Database References	HGNC: 14064 OMIM: 300272 KEGG: hsa:10013 STRING: 9606.ENSP00000334061 UniGene: PMID: 30096875 Mycobacterium tuberculosis infection disturbs the HDAC6/HDAC11 levels to induce IL-10 expression in macrophages. PMID: 29523311 Histone deacetylase 6 (HDAC6) inhibition enhanced glioma stem cells (GSCs) radiosensitivity via inactivating sonic hedgehog protein (SHH)/glioma-associated oncogene homolog 1 (Gli1) pathway. PMID: 29222038 Cortactin (CTTN) silencing in megakaryocyte (MK) phenocopies histone deacetylase 6 (HDAC6) inactivation and knockdown leads to a strong proplatelet formation (PPF) defect. PMID: 29176689 Hdac5 and Hdac6 expression are required for the adequate expression of Icer and adipocyte function. Altered adipose expression of the two Hdacs in obesity by hypoxia may contribute to the development of metabolic abnormalities. PMID: 27900262 this study reports that HDAC6 is involved in reactive oxygen species-NF-kappaB signaling pathway related to pro-inflammatory cytokine expression PMID: 29414656 DTBP represents a promising lead structure for the development of HDAC6 inhibitors, with an improvement in specificity conferred by modification of the cap group. We propose for the first time that the underlying mechanism of the anticancer activity of DTBP is attributed to inhibition of HDAC6 activity. PMID: 29427610 To the best of our knowledge, this is the first report of an HDAC6 selective inhibitor bearing a hydrazide ZBG. Its capability to passively cross the blood-brain barrier (BBB), as observed through PAMPA assays, and its low cytotoxicity in vitro, suggested its potential for drug development. PMID: 27404291 we observed an homologous-recombination deficiency (HRD)-associated level of HDAC6 overexpression, which supports a potential role for the effectiveness of HDAC inhibitor treatment in HRD tumors that are characterized by low levels of H4 lysine acetylation. PMID: 28866885 High expression of HDAC6 is associated with chondrosarcoma. PMID: 28586053 HDAC6, a primarily cytoplasmic deacetylase, mediates TGF-beta1-induced EMT in human lung cancer cells via activation of Notch1. PMID: 27499032 Results confirm histone deacetylase 9 (HDAC9) as a major risk gene for large artery stroke with an association in the 3'-UTR. PMID: 28265093 deletion or inhibition of the cytoplasmic shuttling factor HDAC6 suppressed neuritic tau bead formation in neurons. PMID: 28854366 At the recommended phase II dose of ricolinostat of 160 mg daily, the combination with bortezomib and dexamethasone is safe, well-tolerated, and active, suggesting that selective inhibition of HDAC6 is a promising approach to multiple myeloma therapy. PMID: 28053023 Increased HDAC6 expression is associated with renal cell carcinoma. PMID: 28128740 Our work shows that RanBPM, together with the CTLH complex, associates with HDAC6 and restricts cell migration through inhibition of HDAC6 activity. This study uncovers a novel function for the CTLH complex and suggests that it could have a tumour suppressive role in restricting HDAC6 oncogenic properties. PMID: 28668087 Results provide evidence that HDAC6 mediates the HIV-1 Tat-induced expression of chemokines by regulating reactive oxygen species-Nox2-based NADPH oxidase pathways in astrocytes. Furthermore, there is crosstalk between HDAC6 and NADPH oxidase in HIV-1 Tat-induced chemokine expression in astrocytes. PMID: 28499252 The development of this ACY-1215-resistant cell line has provided valuable insights into the mechanistic role of HDAC6 in lymphoma and offered a novel method to identify rational synergistic drug combinations. PMID: 27993968 rhTGF-beta1 affects sensitivity of human osteoblasts towards mechanical stimuli by damaging the microtubule structure of primary cilia in a HDAC6-dependent manner. PMID: 28271209 In conclusion, HDAC6 might enhance aggressive melanoma cells progression via interacting with PTPN1, which was independent of its histone modifying activity. PMID: 29278704 Using motor neurons derived from induced pluripotent stem cells from patients with amyotrophic lateral sclerosis and FUS mutations, axonal transport defects could be successfully rescued by HDAC6 inhibitors or silencing HDAC6. PMID: 29021520 Data show that selective histone deacetylase 6 (HDAC6) inhibition or knockdown of HDAC6 expression was able to prevent caspase 3 activation in lung endothelial cells and maintain lung endothelial cell-cell junctions. PMID: 27419634 The HDAC6 Inhibitor Tubacin Induces Release of CD133(+) Extracellular Vesicles From Cancer Cells. PMID: 28452069 MicroRNA-22 Promoted Osteogenic Differentiation of Human Periodontal Ligament Stem Cells by Targeting HDAC6 PMID: 28195408 A decrease of HDAC6 expression caused by Helicobacter pylori infection is associated with oncogenic transformation in gastric cancer. PMID: 28700998 these results suggest that HDAC1 and HDAC6 may play a role in clear cell renal cell carcinoma biology PMID: 27506904 Genetic abrogation of HDAC6 in primary melanoma samples and cell lines, down-regulates the expression of PD-L1, an important co-stimulatory molecule expressed in cancer cells, which activates the inhibitory regulatory pathway PD-1 in T-cells. PMID: 26775640 activation appears to be a key survival mechanism for HDAC6 inhibitor treatment. PMID: 27362804 ARID1A mutation inactivates the apoptosis-promoting function of p53 by upregulating HDAC6, indicating that pharmacological inhibition of HDAC6 is a therapeutic strategy for ARID1A-mutated cancers. PMID: 28737768 7-amino-4-methylcoumarin did not affect acetyllysine preference in a multiply acetylated substrate. In contrast, AMC significantly enhanced KDAC6 substrate affinity, greatly reduced Sirt1 activity, eliminated the substrate sequence specificity of KDAC4, and had no consistent effect with KDAC8 substrates. PMID: 28749131 deacetylation of MST1 mediated by HBXIP-enhanced HDAC6 results in MST1 degradation in a chaperone-mediated autophagy (CMA). manner in promotion of breast cancer growth. PMID: 26657153 Suggest that HDAC4 and HDAC6 are guardians of irradiation-induced DNA damage and stemness, thus promoting radioresistance in glioblastoma cells. PMID: 28342984 These results indicate overlapping and distinct functions of HDAC6 and SIRT2. PMID: 27311481 Results provide evidence that HDAC6 could regulate HMGN2 acetylation levels and binding to Stat5a-responsive promoters, and therefore, Stat5a transcriptional activity in breast cancer cells. PMID: 27358110 HDAC6 promotes glioblastoma cell proliferation and confers resistance to temozolomide. PMID: 27267806 The authors characterized the histone deacetylase 6-interacting proteins in LNCaP metastatic prostate cancer cells and found that histone deacetylase 6 interacts with proteins involved in several cellular processes, including autophagy. PMID: 26643866 HDAC6 may represent an optimal target for future immunosuppressant therapeutics with a particular role in transplantation. PMID: 27222932 a combination regimen of bortezomib and the histone deacetylase inhibitor trichostatin A abolished HDAC6 activity and decreased autophagy induction while significantly enhancing bortezomib-induced apoptosis in HNSCC cells. PMID: 27369083 this review highlights current data illustrating the complexity and importance of HDAC6 in viral pathogenesis. [review] PMID: 27959772 Systemic lupus erythematosus patients had higher methylation in the HDAC6 promoter and lower HDAC6 mRNA expression than the controls. These changes may be related to the susceptibility of SLE. However, they are not associated with the disease activity of SLE. PMID: 26461065 Cutaneous T-cell lymphoma (CTCL) pathogenesis remains unknown, and there are no curative therapies. Our findings not only demonstrate a critical role for IL15-mediated inflammation in cutaneous T-cell lymphomagenesis, but also uncover a new oncogenic regulatory loop in CTCL involving IL15, HDAC1, HDAC6, and miR-21 that shows differential sensitivity to isotype-specific HDAC inhibitors PMID: 27422033 HDAC6 confers resistance to vemurafenib in BRAF-mutant melanoma cells. PMID: 28035401 The inhibition of HDAC6 may be a promising strategy for the treatment of lung adenocarcinoma. PMID: 27221381 Data show that expressions of histone deacetylase 6 protein (HDAC6) and c-myc protein are increased in fibroblasts transformed with activated K-ras protein. PMID: 26848526 Overexpression of HDAC6 confers non-small cell lung cancer resistance to sorafenib. PMID: 27090797 these data indicate that HDAC6, and acetylated alpha-tubulin, are important regulator of adipocyte differentiation. PMID: 26363102 HDAC5 and HDAC6 were highly expressed in melanoma cells but exhibited low expression levels in normal skin cells. PMID: 26747087 Study found that HDAC6 was significantly down-regulated in hepatocellular carcinoma cells (HCC) and the low expression of HDAC6 was closely associated with high recurrence rate of HCC patients with liver transplantation. PMID: 26086159 results provide new mechanistic insights into the understanding that deacetylation of HSPA5 by HDAC6 facilitates GP78-mediated HSPA5 ubiquitination PMID: 26119938 TGF-beta increased activity of HDAC6 without affecting its expression levels. PMID: 26763233

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.