Recombinant Human High Affinity Immunoglobulin Epsilon Receptor Subunit Gamma (FCER1G) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-08625P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human High Affinity Immunoglobulin Epsilon Receptor Subunit Gamma (FCER1G) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-08625P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human High Affinity Immunoglobulin Epsilon Receptor Subunit Gamma (FCER1G) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P30273
Target Symbol FCER1G
Synonyms Fc fragment of IgE; high affinity I; receptor for; gamma polypeptide; Fc receptor gamma chain; Fc-epsilon RI-gamma; FCER1G; FCERG_HUMAN; FceRI gamma; FCRG; FcRgamma; High affinity immunoglobulin epsilon receptor subunit gamma; IgE Fc receptor subunit gamma; Immunoglobulin E receptor; high affinity; gamma chain
Species Homo sapiens (Human)
Expression System E.coli
Tag N-GST
Target Protein Sequence LGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
Expression Range 19-86aa
Protein Length Full Length of Mature Protein
Mol. Weight 34.8kDa
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Adapter protein containing an immunoreceptor tyrosine-based activation motif (ITAM) that transduces activation signals from various immunoreceptors. As a component of the high-affinity immunoglobulin E (IgE) receptor, mediates allergic inflammatory signaling in mast cells. As a constitutive component of interleukin-3 receptor complex, selectively mediates interleukin 4/IL4 production by basophils, priming T-cells toward effector T-helper 2 subset. Associates with pattern recognition receptors CLEC4D and CLEC4E to form a functional signaling complex in myeloid cells. Binding of mycobacterial trehalose 6,6'-dimycolate (TDM) to this receptor complex leads to phosphorylation of ITAM, triggering activation of SYK, CARD9 and NF-kappa-B, consequently driving maturation of antigen-presenting cells and shaping antigen-specific priming of T-cells toward effector T-helper 1 and T-helper 17 cell subtypes. May function cooperatively with other activating receptors. Functionally linked to integrin beta-2/ITGB2-mediated neutrophil activation. Also involved in integrin alpha-2/ITGA2-mediated platelet activation.
Subcellular Location Cell membrane; Single-pass type I membrane protein.
Protein Families CD3Z/FCER1G family
Database References

Gene Functions References

  1. FCER1G was identified and validated in association with ccRCC progression and prognosis, which might improve the prognosis by influencing immune-related pathways PMID: 29209141
  2. mass spectrometry of WT human FcRgamma from receptor-stimulated cells shows consistent preferential phosphorylation of the serine residue at position 51. PMID: 27630214
  3. FcgammaR-mediated Syk activation leads to NLRP3 inflammasome-dependent IL-1beta production in macrophages and suggests that an Nlrp3- and IL-1R-dependent process contributes to the IgA response important for protection against Francisella tularensis LVS. PMID: 27365531
  4. Data indicate that the decreasing trend in the expression level of TCRzeta chain, ZAP-70 kinase and epsilon Fc Receptors FcvarepsilonRIgamma was significantly associated with disease progression. PMID: 25513989
  5. Studies indicate that in response to stimulation with antigen, PHB1 translocated to plasma membrane lipid rafts to form a ternary complex with the high-affinity IgE receptor FcepsilonRIgamma and the nonreceptor tyrosine kinase Syk. PMID: 24023253
  6. High expression of FCER1G is associated with chronic myeloid leukemia. PMID: 23228155
  7. There was loss of the negative correlation in the expression levels of CD3eta and FcepsilonRIgamma genes in CLL patients. PMID: 22664044
  8. CD2-associated adaptor protein (CD2AP) positively regulates blood dendritic cell antigen 2 (BDCA2)/FcepsilonR1gamma signaling by forming a complex with SH2 domain-containing inositol 5'-phosphatase (SHIP)1 to inhibit the E3 ubiquitin ligase Cbl. PMID: 22706086
  9. Altered expression of the TCR signaling related genes CD3 and FcepsilonRIgamma in patients with aplastic anemia. PMID: 22401598
  10. Conservation of FcepsilonRI gamma chain coding region in normals and in SLE patients. PMID: 11898918
  11. FCGR3B quantification confirms the idea of the HNA-1c antigen to be inherited not only linked to HNA-1a, but also to be passed down on its own. PMID: 12366784
  12. Overexpression of the Fc epsilon RI gamma chain in normal T cells associates with TCR/CD3 complex, contributes to altered T cell signaling, and down-regulates the endogenous TCR zeta-chain expression in human T cells. PMID: 12626537
  13. evidence that FcepsilonRI-gamma (gamma) associates with 2DL4 to promote surface expression and provide signal transducing function. PMID: 15778339
  14. Data suggest that by associating with Fc epsilon RI gamma, BDCA2 activates a novel BCR-like signaling pathway to regulate the immune functions of plasmacytoid dendritic cells. PMID: 17850179
  15. The activating functions of KIR2DL4 killer receptor in natural killer (NK) cells are compartmentalized into distinct structural modules through transmembrane association with the Fc epsilon RI-gamma (FCERIG) receptor. PMID: 18292514
  16. Elf-1 in combination with Sp1 and GABP reduced FcRgamma promoter activity. PMID: 18378679
  17. reduced expression in histamin non-releaser basophils PMID: 19362683

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed