Recombinant Human High Affinity Immunoglobulin Epsilon Receptor Subunit Alpha (FCER1A) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-02900P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human High Affinity Immunoglobulin Epsilon Receptor Subunit Alpha (FCER1A) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-02900P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human High Affinity Immunoglobulin Epsilon Receptor Subunit Alpha (FCER1A) Protein (His-SUMO) is produced by our E.coli expression system. This is a extracellular protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P12319 |
| Target Symbol | FCER1A |
| Synonyms | Fc epsilon RI alpha; Fc epsilon RI alpha chain ; Fc epsilon RI alpha-chain; Fc fragment of IgE high affinity I receptor for alpha polypeptide; Fc fragment of IgE; high affinity I; receptor for; alpha subunit; Fc fragment of IgE; high affinity I; receptor for; alpha polypeptide; Fc IgE receptor alpha polypeptide; Fc IgE receptor; alpha chain; Fc IgE receptor; alpha polypeptide; Fc of IgE high affinity I receptor for alpha polypeptide; Fc-epsilon RI-alpha; FCE 1A; FCE1A; FCER 1A; Fcer1a; FCERA_HUMAN; FceRI alpha; FcERI; high affinity IgE receptor; High affinity immunoglobulin epsilon receptor alpha subunit; high affinity immunoglobulin epsilon receptor alpha-subunit; High affinity immunoglobulin epsilon receptor subunit alpha; IgE Fc receptor alpha subunit; IgE Fc receptor subunit alpha; Immunoglobulin E receptor high affinity of mast cells alpha polypeptide ; immunoglobulin E receptor; high-affinity; of mast cells; alpha polypeptide |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ |
| Expression Range | 26-205aa |
| Protein Length | Extracellular Domain |
| Mol. Weight | 37.0kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines. |
| Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
| Database References | HGNC: 3609 OMIM: 147140 KEGG: hsa:2205 STRING: 9606.ENSP00000357097 UniGene: PMID: 29243845 |
