Recombinant Human Herpesvirus 6B Protein U24 (U24) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-07942P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Herpesvirus 6B Protein U24 (U24) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-07942P
Regular price
$2,89600
$2,896.00
Sale price$9900
$99.00Save $2,797
/
Product Overview
Description | Recombinant Human Herpesvirus 6B Protein U24 (U24) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q9QJ42 |
Target Symbol | U24 |
Synonyms | U24; U24 protein |
Species | Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus) |
Expression System | in vitro E.coli expression system |
Tag | N-10His |
Target Protein Sequence | MDRPRTPPPSYSEVLMMDVMYGQVSPHASNDTSFVECLPPPQSSRSAWNLWNKRRKTFAFLVLTGLAIAMILFIAFVIYVFNVNRRKK |
Expression Range | 1-88aa |
Protein Length | Full Length |
Mol. Weight | 16.2 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Down-regulates the TCR/CD3E complex and the transferrin receptor TFRC in host T-cells by blocking them from recycling back to the cell surface. |
Subcellular Location | Membrane; Single-pass membrane protein. |
Database References | KEGG: vg:1497025 |