Recombinant Human Herpesvirus 1 Accessory Factor Us11 (US11) Protein (His&Myc)

Name: Recombinant Human Herpesvirus 1 Accessory Factor Us11 (US11) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-10991P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Herpesvirus 1 Accessory Factor Us11 (US11) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P04487
Target Symbol	US11
Synonyms	US11; Accessory factor US11; Vmw21
Species	Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	MSQTQPPAPVGPGDPDVYLKGVPSAGMHPRGVHAPRGHPRMISGPPQRGDNDQAAGQCGDSGLLRVGADTTISKPSEAVRPPTIPRTPRVPREPRVPRPPREPREPRVPRAPRDPRVPRDPRDPRQPRSPREPRSPREPRSPREPRTPRTPREPRTARGSV
Expression Range	1-161aa
Protein Length	Full Length
Mol. Weight	25.2 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Plays a role in the inhibition of host immune response. Participates in the inhibition of host autophagy by interacting with and inhibiting host PKR/EIF2AK2. This interaction also prevents the interferon-induced shut down of protein synthesis following viral infection. Downmodulates the host RLR signaling pathway via direct interaction with host DDX58 and IFIH1. Associates with endogenous HSP90 to disrupt the HSP90-TBK1 complex and induces destabilization of host TBK1 through a proteasome-dependent pathway. May also participate in nuclear egress of viral particles through interactions with host NCL and regulation of the viral UL34 mRNA.
Subcellular Location	Host nucleus, host nucleolus. Host cytoplasm. Note=Following infection, it is released into the cell cytoplasm.
Protein Families	Simplex virus US11 protein family
Database References	KEGG: vg:2703439

Gene Functions References

Nucleophosmin Interactions with Human Immunodeficiency Virus Rev and Herpes Simplex Virus US11 PMID: 26624888
Herpes simplex virus 1 Us11 suppresses host interferon beta1 production through the inhibition of the PACT. PMID: 24067967
Herpes simplex virus type 1 virion-derived US11 inhibits type 1 interferon-induced protein kinase R phosphorylation. PMID: 23773021
PKR expression and the PKR binding domain of herpes simplex virus 1 Us11 are required for the antiautophagic activity of Us11. PMID: 23115300
HSV-1 US11 binds to RIG-I and MDA-5 and inhibits their downstream signaling pathway. PMID: 22301138
found an increase in the nucleolar accumulation of US11 in nucleolin-depleted cells, thereby revealing that nucleolin could play a role in US11 nucleocytoplasmic trafficking through one-way directional transport out of the nucleolus PMID: 22130536
By constructing a series of deletion mutants fused with enhanced yellow fluorescent protein, three novel nucleolar localization signals of US11 were for the first time mapped to amino acids 84-125, 126-152, and 89-146, respectively. PMID: 20633584
The binding site of the RNA-binding domain of US11 to RNA was characterized. PMID: 16246910
herpes simplex virus type 1 Us11 gene product is able to counteract the activity of 2'-5' oligoadenylate synthetase, a third cellular protein critical for host defense PMID: 17229694
The results favor an anti-apoptotic activity of US11 polypeptide that appears to be located at the level of mitochondria or upstream signaling pathways. PMID: 18395766

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.