Recombinant Human Herpesvirus 1 Accessory Factor Us11 (US11) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-10991P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Herpesvirus 1 Accessory Factor Us11 (US11) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-10991P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Herpesvirus 1 Accessory Factor Us11 (US11) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P04487 |
| Target Symbol | US11 |
| Synonyms | US11; Accessory factor US11; Vmw21 |
| Species | Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | MSQTQPPAPVGPGDPDVYLKGVPSAGMHPRGVHAPRGHPRMISGPPQRGDNDQAAGQCGDSGLLRVGADTTISKPSEAVRPPTIPRTPRVPREPRVPRPPREPREPRVPRAPRDPRVPRDPRDPRQPRSPREPRSPREPRSPREPRTPRTPREPRTARGSV |
| Expression Range | 1-161aa |
| Protein Length | Full Length |
| Mol. Weight | 25.2 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Plays a role in the inhibition of host immune response. Participates in the inhibition of host autophagy by interacting with and inhibiting host PKR/EIF2AK2. This interaction also prevents the interferon-induced shut down of protein synthesis following viral infection. Downmodulates the host RLR signaling pathway via direct interaction with host DDX58 and IFIH1. Associates with endogenous HSP90 to disrupt the HSP90-TBK1 complex and induces destabilization of host TBK1 through a proteasome-dependent pathway. May also participate in nuclear egress of viral particles through interactions with host NCL and regulation of the viral UL34 mRNA. |
| Subcellular Location | Host nucleus, host nucleolus. Host cytoplasm. Note=Following infection, it is released into the cell cytoplasm. |
| Protein Families | Simplex virus US11 protein family |
| Database References | KEGG: vg:2703439 |
Gene Functions References
- Nucleophosmin Interactions with Human Immunodeficiency Virus Rev and Herpes Simplex Virus US11 PMID: 26624888
- Herpes simplex virus 1 Us11 suppresses host interferon beta1 production through the inhibition of the PACT. PMID: 24067967
- Herpes simplex virus type 1 virion-derived US11 inhibits type 1 interferon-induced protein kinase R phosphorylation. PMID: 23773021
- PKR expression and the PKR binding domain of herpes simplex virus 1 Us11 are required for the antiautophagic activity of Us11. PMID: 23115300
- HSV-1 US11 binds to RIG-I and MDA-5 and inhibits their downstream signaling pathway. PMID: 22301138
- found an increase in the nucleolar accumulation of US11 in nucleolin-depleted cells, thereby revealing that nucleolin could play a role in US11 nucleocytoplasmic trafficking through one-way directional transport out of the nucleolus PMID: 22130536
- By constructing a series of deletion mutants fused with enhanced yellow fluorescent protein, three novel nucleolar localization signals of US11 were for the first time mapped to amino acids 84-125, 126-152, and 89-146, respectively. PMID: 20633584
- The binding site of the RNA-binding domain of US11 to RNA was characterized. PMID: 16246910
- herpes simplex virus type 1 Us11 gene product is able to counteract the activity of 2'-5' oligoadenylate synthetase, a third cellular protein critical for host defense PMID: 17229694
- The results favor an anti-apoptotic activity of US11 polypeptide that appears to be located at the level of mitochondria or upstream signaling pathways. PMID: 18395766
