Recombinant Human Heparin-Binding Growth Factor 2 Protein (FGF2) Protein (His)
Recombinant Human Heparin-Binding Growth Factor 2 Protein (FGF2) Protein (His)
Collections: All products, Buy cytokines, chemokines, and growth factors for research online, Celebrate thanksgiving with 30% off all beta lifescience products!, Explore high-quality enzymes for research and supplementation, Featured enzyme molecules, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins, In-stock recombinant proteins, Kinase, Recombinant fibroblast growth factor basic (fgfb/fgf2/bfgf) proteins
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
| Description | Recombinant Human Heparin-Binding Growth Factor 2 Protein (FGF2) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P09038 |
| Target Symbol | FGF2 |
| Synonyms | Basic fibroblast growth factor; Basic fibroblast growth factor bFGF; BFGF; FGF 2; FGF B; FGF-2; Fgf2; FGF2 basic; FGF2_HUMAN; FGFB; Fibroblast growth factor 2 (basic); Fibroblast growth factor 2; Fibroblast growth factor; basic; HBGF 2; HBGF-2; HBGF2; HBGH 2; HBGH2; Heparin binding growth factor 2 precursor; Heparin-binding growth factor 2; Prostatropin |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Expression Range | 143-288aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 20.4 kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV:ITGB3. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis. Mediates phosphorylation of ERK1/2 and thereby promotes retinal lens fiber differentiation. |
| Subcellular Location | Secreted. Nucleus. |
| Protein Families | Heparin-binding growth factors family |
| Database References |
HGNC: 3676 OMIM: 134920 KEGG: hsa:2247 STRING: 9606.ENSP00000264498 UniGene: PMID: 29989583 |

