Recombinant Human Heparin-Binding Growth Factor 2 Protein (FGF2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-05199P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Heparin-Binding Growth Factor 2 Protein (FGF2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-05199P
Regular price
$39800
$398.00
Sale price$9900
$99.00Save $299
/
Product Overview
Description | Recombinant Human Heparin-Binding Growth Factor 2 Protein (FGF2) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P09038 |
Target Symbol | FGF2 |
Synonyms | Basic fibroblast growth factor; Basic fibroblast growth factor bFGF; BFGF; FGF 2; FGF B; FGF-2; Fgf2; FGF2 basic; FGF2_HUMAN; FGFB; Fibroblast growth factor 2 (basic); Fibroblast growth factor 2; Fibroblast growth factor; basic; HBGF 2; HBGF-2; HBGF2; HBGH 2; HBGH2; Heparin binding growth factor 2 precursor; Heparin-binding growth factor 2; Prostatropin |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Expression Range | 143-288aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 20.4 kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV:ITGB3. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis. Mediates phosphorylation of ERK1/2 and thereby promotes retinal lens fiber differentiation. |
Subcellular Location | Secreted. Nucleus. |
Protein Families | Heparin-binding growth factors family |
Database References | |
Tissue Specificity | Expressed in granulosa and cumulus cells. Expressed in hepatocellular carcinoma cells, but not in non-cancerous liver tissue. |
Gene Functions References
- The Novel Short Isoform of Securin Stimulates the Expression of Cyclin D3 and Angiogenesis Factors VEGFA and FGF2, but Does Not Affect the Expression of MYC Transcription Factor PMID: 29989583
- miR-155 and FGF2 is associated with esophageal cancer progression. miR-155 in Tumor-associated macrophages suppressed ECA109cell proliferation, migration and invasion, as well as reduction in angiogenesis. miR-155-reduced cell growth, migration and invasion of ECA109cells is associated with FGF2 suppression. PMID: 29660336
- the dual warhead-FGF2 conjugate may overcome the potential acquired resistance of FGFR1-overproducing cancer cells towards single cytotoxic drugs. PMID: 30029518
- widely stained in sclerosing stromal tumours of the ovary PMID: 29433373
- FGF2 initiates CYGB transcription via the JNK pathway. PMID: 28916723
- A strong stromal FGF-2 expression was associated with a significantly higher clinical stage and higher biochemical recurrence rate. Patients with strong stromal FGF-2 expression also had a significantly worse biochemical recurrence-free survival. PMID: 29887238
- levels of the angiogenesis mediators endoglin, HB-EGF, BMP-9 and FGF-2 in patients with severe sepsis and septic shock PMID: 28746898
- Our results suggest photodynamic therapy is effective in increasing the expression of bFGF gene, an important factor in periodontal tissue regeneration and could indicate periodontal tissue regeneration PMID: 28935533
- High FGF2 expression is associated with gastric cancer. PMID: 28500362
- Regulation of vascular smooth muscle cell calcification by syndecan-4/FGF-2/PKCalpha signalling and cross-talk with TGF-beta1. PMID: 29016732
- evaluation of the presence and localization of FGF2 in human sperm cells, and determination of FGF2 levels in semen samples and its relationship with conventional semen parameters PMID: 28732140
- We have presented evidence that FGF2 promotes myofibroblast apoptosis in vivo, antagonizes pro-fibrotic TGF-beta signaling, inhibits fibroblast activation and prevents transdifferentiation of non-fibroblasts into myofibroblasts, and promotes a less fibrotic gene expression paradigm [Review] PMID: 28967471
- These results demonstrate that FGF-TGFbeta signaling antagonism is the primary regulator of the smooth muscle cell phenotype switch. PMID: 27634335
- Results describe a novel role of FGF2 as a modulator of osteoblast and mesenchymal stromal cell function, and provide evidence for involvement of FGF2 in leukemia pathogenesis and chemo-resistance. PMID: 27481339
- Under specific experimental conditions, secretion of IL-1beta and FGF2 is triggered by phosphatidylinositol 4,5-bisphosphate [PI(4,5)P2]-dependent formation of pores across the plasma membrane. PMID: 28871048
- HDAC1 depletion activates cardiac mesenchymal stromal cells proangiogenic paracrine signaling in a basic fibroblast growth factor-dependent manner. PMID: 28679560
- The results suggest that FGF2/rs1048201, FGF5/rs3733336 and FGF9/rs546782 are associated with the risk of non-syndromic orofacial cleft and that these miRNA-FGF interactions may affect non-syndromic orofacial cleft development. PMID: 27511275
- TEC is yet another regulator of FGF2-mediated Human pluripotent stem cells pluripotency and differentiation. PMID: 28631381
- bFGF in primary tumor tissue associated with favorable breast cancer outcome and its levels significantly and positively correlated with ER levels. PMID: 28869446
- Serum FGF-2 levels were statistically significantly lower in the autism spectrum patient group compared to healthy controls. PMID: 28734240
- Dysregulation of the FGF2 gene represents an opportunity to understand further, and possibly intervene upon, mechanisms of wound healing in diabetics with CKD. PMID: 27237708
- Out of five FGF-2 Gene Polymorphism loci, the TA genotype of rs308442 in the osteoporosis group (40.2%) was higher than in the control group (29.5%) (p < 0.05). The rs308442 locus of FGF-2 gene is closely correlated to osteoporosis in this Zhuang ethnic Chinese cohort, and the TA may be the risk genotype of osteoporosis. PMID: 28653999
- Up-regulation of FGF2 and down-regulation FAM201A were correlated with the development of osteonecrosis of the femoral head after femoral neck fracture. PMID: 29382571
- over-expression, isolation, and biological activity of all recombinant human FGF2 isoforms, are reported. PMID: 28433654
- We found that hsa-miR-196a-3p affected expression on both mRNA and protein levels of FGF2. our study provided evidence that a functional SNP rs1048201 was associated with bone mineral density (BMD), and SNP rs1048201 variant may act by affecting binding of hsa-miR-196a-3p PMID: 28317323
- Data show that mutant soluble ectodomain of FGFR2IIIc (msFGFR2c) but not wild-type soluble ectodomain of FGFR2IIIc (wsFGFR2c) could selectively bind to c subtype of FGFRs in the presence of FGF-2. PMID: 28049184
- Furthermore, MERS coronavirus induced apoptosis through upregulation of Smad7 and fibroblast growth factor 2 (FGF2) expression in both kidney and lung cells. PMID: 27572168
- The present work aims to investigate the relationship between the expression of AEG-1(astrocyte elevated gene-1), b-FGF(basic-fibroblast growth factor), beta-catenin, Ki-67, TNF-alpha (tumor necrosis factor-alfa) other prognostic parameters in DC (Ductal Carcinomas) and ductal intraepithelial neoplasm. We found a relationship between these factors. PMID: 26096243
- Studies indicate that therapeutically targeting FGF2 and FGFR has been extensively assessed in multiple preclinical studies and numerous drugs and treatment options have been tested in clinical trials. PMID: 27007053
- FGF2 is involved in melanoma development and progression. HMW FGF2 isoforms enhance in vitro motility of melanoma cells. LMW FGF2 confers stem-like features and increases in vivo metastasization. LMW FGF2 promotes angiogenesis while HMW FGF2 induces vasculogenic mimicry. PMID: 27558498
- miR-105/Runx2 axis mediates FGF2-induced ADAMTS expression in osteoarthritis cartilage. PMID: 26816250
- results suggest that MALAT1-mediated FGF2 protein secretion from Tumor-associated macrophages inhibits inflammatory cytokines release, promotes proliferation, migration, and invasion of FTC133 cells and induces vasculature formation. PMID: 28543663
- This study reveals that Adv ECM hydrogels recapitulate matrix fiber microarchitecture of native adventitia, and retain angiogenesis-related actors and bioactive properties such as FGF2 signaling capable of influencing processes important for angiogenesis. PMID: 28167392
- Data show that FGF2 mutants have potential as anti-angiogenic agents and useful tools for studying the role of integrin alphavbeta3 in FGF2 signalling. PMID: 28302677
- Expression of these mediators was confirmed in end-stage COPD. Thus, accumulation of mast cells in COPD may contribute to vascular remodeling. PMID: 28298222
- Results provide evidence that bFGF regulates stemness maintenance in stem cells isolated from human exfoliated deciduous teeth (SHEDs) by enhancing REX-1 mRNA expression via the FGFR and Akt signaling pathways. Moreover, IL-6 is also involved in the bFGF-induced REX1 expression. PMID: 27883224
- Facial nerve regeneration using basic fibroblast growth factor-impregnated gelatin microspheres PMID: 24737684
- These results indicated that FGF-2, but not FGF-10, may be supplemented during stem cell expansion to prime cells for successful chondrogenesis and osteogenesis. PMID: 27411850
- the data suggest that endothelial cells regulate beta-catenin activity in adrenocortical cells also via secretion of basic fibroblast growth factor. PMID: 27889473
- In an in vitro assay of vascular smooth muscle cells, circRNA WDR77 silencing significantly inhibited cell proliferation and migration. Bioinformatics methods revealed that miR-124 and fibroblast growth factor 2 (FGF-2) were downstream targets of circRNA WDR77. PMID: 29042195
- FGF2 protects the tumor cells from the antiproliferative effect of Gefitinib and largely prevents reprogramming of the proteome and phosphoproteome PMID: 27794612
- High FGF2 expression is associated with colon cancer metastasis. PMID: 28629469
- These observations identify airway smooth muscle cells -derived FGF2b as a factor needed for LMC formation by CD4 T cells, affecting intercellular communication. PMID: 28924004
- Report no relationship between serum bFGF levels and ovarian cancer microvessel density and tumor bFGF expression. PMID: 27312585
- High FGF2 expression is associated with ovarian cancer. PMID: 28481872
- The antitumor activity of scopoletin may be due to its strong anti-angiogenic effect, which may be mediated by its effective inhibition of ERK1, VEGF-A, and FGF-2. PMID: 27133199
- TGF-beta, bFGF and epimorphin in the extracellular microenvironment cooperatively affect HSF behaviors under the control of a highly sulfated chondroitin sulfate PMID: 28209294
- High FGF2 expression is associated with lung cancer. PMID: 28423625
- miR-205 enhances chemosensitivity of breast cancer cells to TAC docetaxol, doxorubicin plus cyclophosphamide) by suppressing both VEGFA and FGF2, leading to evasion of apoptosis. PMID: 27362808
- analyses identified a new bFGF-regulating mechanism by which hedgehog signaling regulates human fibroblast migration; this data opens a new avenue for the wound healing therapy PMID: 28363830