Recombinant Human Heat Shock Factor-Binding Protein 1 (HSBP1) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08538P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Heat Shock Factor-Binding Protein 1 (HSBP1) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08538P
Collections: High-quality recombinant proteins, Other recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Heat Shock Factor-Binding Protein 1 (HSBP1) Protein (GST) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | O75506 |
Target Symbol | HSBP1 |
Synonyms | Heat shock factor binding protein 1; Heat shock factor-binding protein 1; HSBP1; HSBP1_HUMAN; HSF1BP; Nasopharyngeal carcinoma associated antigen 13; Nasopharyngeal carcinoma-associated antigen 13; NPC A 13 ; NPC-A-13; NPCA 13 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKIPATQK |
Expression Range | 1-75aa |
Protein Length | Partial |
Mol. Weight | 35.5kDa |
Research Area | Epigenetics And Nuclear Signaling |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Negative regulator of the heat shock response. Negatively affects HSF1 DNA-binding activity. May have a role in the suppression of the activation of the stress response during the aging process. |
Subcellular Location | Nucleus. |
Protein Families | HSBP1 family |
Database References | HGNC: 5203 OMIM: 604553 KEGG: hsa:3281 STRING: 9606.ENSP00000392896 UniGene: PMID: 28828227 |