Recombinant Human Heart- And Neural Crest Derivatives-Expressed Protein 2 (HAND2) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-09198P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Heart- And Neural Crest Derivatives-Expressed Protein 2 (HAND2) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-09198P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Heart- And Neural Crest Derivatives-Expressed Protein 2 (HAND2) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P61296
Target Symbol HAND2
Synonyms AI225906; AI661148 ; autonomic nervous system and neural crest derivatives-expressed protein 2; Basic helix loop helix transcription factor HAND2; bHLHa26; Class A basic helix-loop-helix protein 26; Deciduum; Deciduum heart autonomic nervous system and neural crest derivatives expressed protein 2; DHAND 2; dHAND; DHAND2; Ehand 2; Ehand2; FLJ16260; HAND 2; Hand2; HAND2_HUMAN; Heart and neural crest derivatives expressed 2; Heart and neural crest derivatives expressed protein 2; heart and neural crest derivatives expressed transcript 2; heart; Heart- and neural crest derivatives-expressed protein 2; Hed; Highly similar to dHAND M musculus; MGC125303; MGC125304; Th 2; Th2; Thing 2; Thing2
Species Homo sapiens (Human)
Expression System E.coli
Tag N-GST
Target Protein Sequence MSLVGGFPHHPVVHHEGYPFAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSMALSYSPEYASGTANRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELKQ
Expression Range 1-180aa
Protein Length Full Length of Isoform 2
Mol. Weight 47.3kDa
Research Area Epigenetics And Nuclear Signaling
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Essential for cardiac morphogenesis, particularly for the formation of the right ventricle and of the aortic arch arteries. Required for vascular development and regulation of angiogenesis, possibly through a VEGF signaling pathway. Plays also an important role in limb development, particularly in the establishment of anterior-posterior polarization, acting as an upstream regulator of sonic hedgehog (SHH) induction in the limb bud. Is involved in the development of branchial arches, which give rise to unique structures in the head and neck. Binds DNA on E-box consensus sequence 5'-CANNTG-3'.
Subcellular Location Nucleus.
Database References

HGNC: 4808

OMIM: 602407

KEGG: hsa:9464

STRING: 9606.ENSP00000352565

UniGene: PMID: 28469241

  • HAND2 mRNA and protein low expressed in endometrial carcinoma (EC) tissues, which suggested the degree of endometrial malignancy. PMID: 29767873
  • The results identify HAND2 loci associated with susceptibility to early onset atrial fibrillation in a Korean population. PMID: 28460022
  • These findings indicate that HAND2 loss-of-function mutation contributes to human CHD, perhaps via its interaction with GATA4 and NKX2.5. PMID: 26865696
  • HAND2 and microRNA-1 facilitated the early progress of human induced cardiomyocyte-like cells reprogramming. PMID: 28796841
  • this study is the first to report the association of a HAND2 loss-of-function mutation with an increased vulnerability to tetralogy of Fallot in humans, which provides novel insight into the molecular mechanism underpinning congenital heart disease PMID: 26676105
  • HAND2-mediated proteolysis negatively regulates the function of estrogen receptor alpha. PMID: 26166202
  • suggest that HAND2 plays a key role in the regulation of progestin-induced decidualization of human endometrial stromal cells. PMID: 24745730
  • Reduced protein expression of HAND2 in the myenteric plexus of the aganglionic segment would suggest that HAND2 was involved in the pathogenesis of Hirschsprung disease. PMID: 24210200
  • Increased HAND2 methylation was a feature of premalignant endometrial lesions and was seen to parallel a decrease in RNA and protein levels. PMID: 24265601
  • Overdosage of Hand2 causes limb and heart defects in the human chromosomal disorder partial trisomy distal 4q. PMID: 23449628
  • No evidence of linkage between HAND2 and CL/P was obtained. Levelss of exclusion were obtained with different inheritance models. results did not support HAND2 in CL/P PMID: 21431856
  • Expression analyses on both Hand2 conditionally null and hypomorphic backgrounds demonstrate that Hand2 is required for reporter activation in a gene dosage-dependent manner during sympathetic neurogenesis. PMID: 22323723
  • Data suggest Hand2 plays an important role in decidualization; expression of Hand2 is significantly increased in response to prostaglandin E2. PMID: 21527398
  • These data suggest that cytokines can inhibit norepinephrine transporter expression through downregulation of Hand2 or Gata3 in cultured sympathetic neurons, but axotomy in adult animals selectively suppresses Hand2 expression. PMID: 21241805
  • Hand2 performs an essential role during transgenic epicardialization, directly impacting epicardial cell differentiation and formation of the coronary vasculature. PMID: 21350214
  • HAND2 may be a potential candidate gene of stenosis of the right ventricle, outflow tract. PMID: 20819618
  • dHAND/E-protein (E2A, ME2, and ALF1) heterodimers have distinct DNA binding specificities PMID: 15351717
  • These results demonstrate the direct interactions of the Phox2a and b and dHAND transcription factors within a noradrenergic cell type PMID: 16280598
  • demonstrate evolutionarily conserved functions of HAND transcription factors in Drosophila and mammalian cardiogenesis, and reveal a previously unrecognized requirement of Hand genes in hematopoiesis PMID: 16467358
  • Hand2 plays a pivotal role in regulating both cell-autonomous and -nonautonomous functions of the cardiac neural crest. PMID: 19008477
  • Expression of HAND2 and DEIN genes in neuroblastoma is co-regulated by asymmetrical activity of this promoter and modulated by the activity of two cis-regulatory elements acting as weak repressors PMID: 19348682
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed