Recombinant Human Gtpase Eras (ERAS) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08295P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Gtpase Eras (ERAS) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08295P
Collections: High-quality recombinant proteins, Other recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Gtpase Eras (ERAS) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q7Z444 |
Target Symbol | ERAS |
Synonyms | E ras; E-Ras; ecat5; Embryonic stem cell expressed Ras ; Embryonic stem cell-expressed Ras; Eras; ES cell expressed Ras; GTPase ERas; Ha-Ras2; HRAS2; HRASP; MGC126691; MGC126693; OTTHUMP00000065857 ; RASE_HUMAN; Small GTPase protein E Ras; v Ha ras Harvey rat sarcoma viral oncogene homolog pseudogene ; v Ha ras Harvey rat sarcoma viral oncogene homolog 2 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | LPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEPMARSCREKTRHQKATCHCGC |
Expression Range | 3-230aa |
Protein Length | Partial |
Mol. Weight | 28.8kDa |
Research Area | Epigenetics And Nuclear Signaling |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the tumor-like growth properties of embryonic stem cells. |
Subcellular Location | Cell membrane; Lipid-anchor; Cytoplasmic side. |
Protein Families | Small GTPase superfamily, Ras family |
Database References | HGNC: 5174 OMIM: 300437 KEGG: hsa:3266 STRING: 9606.ENSP00000339136 UniGene: PMID: 25940089 |