Recombinant Human Gtp-Binding Protein Di-Ras3 (DIRAS3) Protein (GST)

Name: Recombinant Human Gtp-Binding Protein Di-Ras3 (DIRAS3) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-09110P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Gtp-Binding Protein Di-Ras3 (DIRAS3) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	O95661
Target Symbol	DIRAS3
Synonyms	DIRA3; DIRA3_HUMAN; DIRAS family GTP binding RAS like 3; DIRAS family GTPase 3; DIRAS family; GTP-binding RAS-like protein 3; DIRAS3; Distinct subgroup of the Ras family member 3; GTP binding protein Di Ras3; GTP-binding protein Di-Ras3; NOEY2; Ras homolog gene family member I; Rho related GTP binding protein RhoI; Rho-related GTP-binding protein RhoI; RHOI
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM
Expression Range	1-229aa
Protein Length	Full Length
Mol. Weight	52.8 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Subcellular Location	Cell membrane; Lipid-anchor; Cytoplasmic side.
Protein Families	Small GTPase superfamily, Di-Ras family
Database References	HGNC: 687 OMIM: 605193 KEGG: hsa:9077 STRING: 9606.ENSP00000360020 UniGene: PMID: 30043279 lncRNA GAS5 functions as a competing endogenous RNA for miR-221 to suppress cell growth and EMT in osteosarcoma by regulating the miR-221/ARHI pathway. PMID: 28519068 DiRas3 binds to KSR1 independently of its interaction with activated Ras and RAF. PMID: 27368419 We demonstrate that DIRAS3 knock-down (KD) in adipose stromal/progenitor cells (ASCs) induces activation of Akt-mTOR signaling and proliferation arrest. DIRAS3 KD ASCs lose the potential to form colonies and are negative for Ki-67. Moreover, silencing of DIRAS3 results in a premature senescence phenotype. PMID: 28316325 ARHI-mediated up-regulation of glycolysis and glutaminolysis was found to be autophagy-dependent and inhibition of these metabolic pathways resulted in decreased cell viability. PMID: 27784287 The overexpression of ARHI promotes colon cancer SW480 cell apoptosis by inhibiting the level of Akt. PMID: 27774944 Transcriptional, but not post-transcriptional, silencing of GNG12-AS1 causes concomitant upregulation of DIRAS3, indicating a function in transcriptional interference. PMID: 26832224 ARHI mRNA and protein expression is markedly decreased in osteosarcoma MG-63 cells lines. Overexpression of ARHI inhibits cell viability and proliferation. PMID: 26165148 ARHI-mediated autophagy-associated cell death enhances chemosensitivity to cisplatin in ovarian cancer cell lines and xenografts. PMID: 26247722 EZH2-''induced H3K27me3 is associated with epigenetic repression of the ARHI tumor-suppressor gene in epithelial ovarian cancer PMID: 25077680 ARHI competes with RanGTPase and interacts with importin beta via basic-acidic patch interaction, which leads to inhibition of STAT3 translocation. PMID: 25499977 Letter: ARHI suppresses pancreatic cancer by regulating ERK 1/2 signaling. PMID: 25675421 JMJD2A-dependent silencing of Sp1 in advanced breast cancer promotes metastasis by downregulation of DIRAS3. PMID: 25193278 suggest that DIRAS3 not only regulates the autophagosome initiation complex, but induces autophagy in dormant, nutrient-deprived ovarian cancer cells that remain after conventional chemotherapy, facilitating their survival PMID: 24879154 ARHI is required for autophagy-meditated cancer cell arrest and ARHI inhibits signaling through PI3K/AKT and Ras/MAP by enhancing internalization and degradation of the epidermal growth factor receptor. PMID: 24769729 The silence of ARHI expression in vitro seems to accelerate the malignant transformation of healthy ovarian cells by restraining apoptosis and autophagy. PMID: 24476894 ARHI acts as a tumor suppressor gene in MDA-MB-231 cells and, although trichostatin A+5-aza-2'-deoxycytidine can block the cells at different cell cycle phase, the antitumor effect is ARHI-dependent. PMID: 24676336 Loss of ARHI expression is associated with glioma. PMID: 24458808 ARHI acts as a tumor suppressor by downregulating the NFkappaB signaling pathway, which results in the inhibition of cell proliferation, apoptosis and the cell cycle in the pancreatic tumor PANC-1 cell line PMID: 23447002 overexpression of ARHI gene might be associated with the inhibition of lung cancer cell growth, proliferation and invasion, and the promotion of apoptosis. PMID: 23247805 Results indicate that the aplysia ras homolog member I (ARHI) 3'UTR was a direct target of miR-221 in breast cancer MCF-7 cells. PMID: 23801152 acetylated STAT3 bound to the ARHI promoter and recruited DNA methyltransferase 1 for genetic modification. PMID: 23604529 Imprinted chromatin around DIRAS3 regulates alternative splicing of GNG12-AS1, a long noncoding RNA. PMID: 23871723 Expression of JMJD2A in infiltrating duct carcinoma is higher than in fibroadenoma, and is associated with ARHI, p53 and ER PMID: 23678541 DiRas3 interacts with C-RAF and downregulates MEK1 activity to restrict cell migration. PMID: 23157514 ARHI expression is present in the endometrium and up-regulated in ectopic endometrium, whereas in the ectopic endometrium of patients with malignant endometriosis its expression is often negative. PMID: 21602127 ARHI expression is downregulated in human gastric cancer and it may be a novel tumor suppressive target for gastric cancer therapy. PMID: 22497484 The consequence of complex formation is a DiRas3-mediated recruitment and anchorage of C-RAF to components of the membrane skeleton, suppression of C-RAF/B-RAF heterodimerization, and inhibition of C-RAF kinase activity. PMID: 22605333 downregulation of ARHI may play an important role both in the pathogenesis and aggravation of gastric cancer. ARHI gene CpG island methylation is a potential molecular basis of its downregulation. PMID: 22427032 The level of ARHI mRNA was significantly lower in aggressive compared with non-aggressive prostate cancer tissue samples PMID: 22117988 ARHI has a critical and previously uncharacterized role in the regulation of ovarian cancer cell migration. PMID: 21643014 ARHI has pro-apoptotic effects on HCC cells, which is associated with the inactivation of both Akt and NF-kappaB survival pathways. PMID: 21933150 Data show that ARHI re-expression induces autophagic cell death in breast cancer cells and enhances the inhibitory effects of paclitaxel by promoting autophagy, apoptosis, and G2/M cell cycle arrest. PMID: 21244707 These data highlighted an important role for ARHI in controlling hepatocellular carcinoma growth and angiogenesis. PMID: 21093415 DIRAS3 gene is imprinted, with monoallelic expression from the paternal allele. PMID: 9874798 Data show that ARHI could compete for Ran-importin binding and induce disruption of importin-binding to cargo proteins, including STAT3. PMID: 19435463 A link between NOEY2 loss expression and the spreading mechanism of breast cancer may possibly exist. PMID: 12485503 ARHI inhibits cell growth, and loss of its expression in cells may contribute to the development of breast and ovarian cancers PMID: 12771940 Hypermethylation of CpG island II in the promoter region of ARHI is associated with the complete loss of ARHI expression in breast cancer cells. PMID: 12874023 ARHI may have a role in development and progression of ductal breast carcinoma in situ PMID: 14506155 Association between STAT3 and ARHI as well as the functional inhibition of STAT3 transcriptional activity by ARHI suggests a novel mechanism through which a putative tumor suppressor gene can inhibit STAT3 activity in breast and ovarian cancers. PMID: 16061651 Down-regulation of ARHI gene is associated with breast cancer PMID: 16158053 Down-regulation of ARHI due to loss of heterozygosity and promoter methylation is associated with ovarian cancers PMID: 18286529 DIRAS3 is a novel, prognostically relevant candidate gene that is frequently methylated and silenced in oligodendroglial tumors with 1p deletion. PMID: 18302158 provide evidences that ARHI downregulated in HCCs could play a role in liver cancer via acting as a tumor suppressor gene, which mainly was triggered by the epigenetic events in HCC specimens PMID: 18612997 ARHI can induce autophagic cell death, but can also promote tumor dormancy in the presence of factors that promote survival in the cancer microenvironment. PMID: 19033662 The presence of NOEY2 mutations in human breast cancer and early-stage lesions indicates that NOEY2 mutations may be partly associated with breast tumourigenesis. PMID: 19482475 ARHI represents a modulator of cancer cell proliferation and may play an important role in the development of pancreatic cancer. PMID: 19639215 Loss of heterozygosity at 1p31 (including ARHI) did not correlate with the mitotic activity index nor provide prognostic information. PMID: 19759414

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.