Recombinant Human Grpe Protein Homolog 1, Mitochondrial (GRPEL1) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08693P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Grpe Protein Homolog 1, Mitochondrial (GRPEL1) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08693P
Collections: High-quality recombinant proteins, Other recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Grpe Protein Homolog 1, Mitochondrial (GRPEL1) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q9HAV7 |
Target Symbol | GRPEL1 |
Synonyms | FLJ25609; GREPEL 1; GREPEL1; GrpE like 1; GrpE like 1 mitochondrial; GrpE like protein cochaperone; GrpE protein homolog 1 mitochondrial; GrpE protein homolog 1; mitochondrial; GRPE1_HUMAN; GRPEL 1; Grpel1; HMGE; Mt GrpE#1; Mt-GrpE#1 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | CTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA |
Expression Range | 1-217aa |
Protein Length | Full Length |
Mol. Weight | 48.3kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins. |
Subcellular Location | Mitochondrion matrix. |
Protein Families | GrpE family |
Database References | HGNC: 19696 OMIM: 606173 KEGG: hsa:80273 STRING: 9606.ENSP00000264954 UniGene: PMID: 28848044 |