Recombinant Human Growth-Regulated Alpha Protein (CXCL1) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-09349P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Growth-Regulated Alpha Protein (CXCL1) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-09349P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Growth-Regulated Alpha Protein (CXCL1) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P09341
Target Symbol CXCL1
Synonyms C-X-C motif chemokine 1; Chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity; alpha); chemokine (C-X-C motif) ligand 1; CINC-1; CXCL1; Cytokine-induced neutrophil chemoattractant 1; Fibroblast secretory protein ; Fsp; Gro 1; Gro A; Gro; GRO protein; alpha; GRO-alpha(1-73); GRO-alpha(6-73); Gro1; GRO1 oncogene (melanoma growth stimulating activity; alpha); GRO1 oncogene (melanoma growth-stimulating activity) ; Gro1 oncogene; GROa; GROA_HUMAN; Growth-regulated alpha protein; KC; KC chemokine; mouse; homolog of; melanoma growth stimulatory activity alpha ; Melanoma growth stimulatory activity; Melanoma growth stimulatory activity; alpha; MGSA alpha ; MGSA; MGSA-a; N51; NAP-3; NAP3; Neutrophil-activating protein 3; Platelet-derived growth factor-inducible protein KC; Scyb 1; Scyb1; Secretory protein N51; Small inducible cytokine subfamily B; member 1
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His-SUMO
Target Protein Sequence ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Expression Range 35-107aa
Protein Length Full Length of Mature Protein
Mol. Weight 23.9kDa
Research Area Immunology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity.
Subcellular Location Secreted.
Protein Families Intercrine alpha (chemokine CxC) family
Database References

HGNC: 4602

OMIM: 155730

KEGG: hsa:2919

STRING: 9606.ENSP00000379110

UniGene: PMID: 30201019

  • CXCL1 displays a specific microRNA (miR) upregulated by the prototypical colon cancer onco-miR miR-105. PMID: 30115896
  • These results show that AKIP1 is crucial in cervical cancer angiogenesis and growth by elevating the levels of the NF-kappaB-dependent chemokines CXCL1, CXCL2, and CXCL8. PMID: 29520695
  • Adipose stromal cells recruitment to tumours, driven by CXCL1 and CXCL8, promotes prostate cancer progression. PMID: 27241286
  • CXCL1, which is produced by breast cancer cells, can promote cancer growth and development PMID: 29438938
  • miR-204 inhibits cell proliferation in gastric cancer by targeting CKS1B, CXCL1 and GPRC5A. PMID: 29283424
  • Thrombocytosis was more prevalent in patients with inflammatory breast cancer (IBC)than in those with non-IBC and it was associated with poor prognosis. GRO and TGF-beta were associated with thrombocytosis in IBC PMID: 28831670
  • the plasma concentrations of CXCL1 indicated the disease activity and prognosis in interstitial pneumonia with autoimmune features (IPAF). Thus, the CXCL1/CXCR2 axis appears to be involved in the progression of IPAF. PMID: 27958346
  • CXCL1/8 secreted by adipose-derived mesenchymal stem cells could promote breast cancer angiogenesis. PMID: 28514506
  • GROA overexpression is associated with invasion in triple negative breast cancer. PMID: 28560447
  • The results of the transwell chemotaxis assay also supported the above results. Our data suggest that APN can promote h-JBMMSC chemotaxis by up-regulating CXCL1 and CXCL8 PMID: 28176455
  • This study highlighted CAF-secreted CXCL1 as an attractive target to reverse tumor radioresistance. PMID: 28518141
  • we identified the microRNA miR-200a as a putative post-transcriptional regulator of CXCL1 in hepatocellular carcinoma PMID: 27542259
  • study demonstrates that CXCL1 can transform NOFs into senescent CAFs via an autocrine mechanism PMID: 29360827
  • Association of polymorphic markers of chemokine genes, their receptors, and CD14 gene with coronary atherosclerosis PMID: 29369549
  • GROalpha high in the tumor microenvironment can be used as potential indicators for the progression of non-small cell lung cancer PMID: 28375674
  • IL-8, but not the CXCL1 circuit, is critical for the regulation of thyroid cancer stem cells. PMID: 27577959
  • this study shows that CXCL1 is expressed in epithelium of the endometrium with adenomyosis and demonstrate that VEGF is capable of inducing CXCL1 expression PMID: 27665197
  • Taken together, the present study indicates that IL-33 localized in the human atherosclerotic plaque increases GRO-alpha mRNA expression and protein secretion via activation of ERK1/2, JNK, and NF-kappaB in HUVECs, suggesting that IL-33 plays an important role in the pathophysiology and development of atherosclerosis. PMID: 28637660
  • Study provides the first evidence that primary malignant cell-secreted VEGFA stimulates tumor-associated macrophages to produce CXCL1, which recruits CXCR2-positive MDSCs to form a premetastatic niche to promote liver metastases. PMID: 28455419
  • the presence of elevated circulating levels of VEGF and CXCL1 are predictive of liver and lung metastasis, respectively of colorectal cancer. PMID: 28870907
  • This study describe elevated levels of CXCL1 and it receptor in the Solid Component and Cyst Fluid of Human Adamantinomatous Craniopharyngioma, relative to other pediatric brain tumors and normal cerebral tissue. PMID: 28859336
  • The expressions of CXCL1 in cancer cells and CXCR2 in stromal cells are useful prognostic factors for gastric cancer patients PMID: 28575019
  • CXCL1 secreted by tumor-associated lymphatic endothelial cells promotes lymph node metastasis of gastric cancer through integrin beta1/FAK/AKT signaling pathway. PMID: 27832972
  • S100A9 and S100A12 may have a role in the pathogenesis of pneumonia: S100A9 and CXCL1 may contribute solely in mild pneumonia, and CCL5 and CXCL11 may contribute in severe pneumonia. PMID: 28381820
  • These findings support a role for CXCL1 and IL-8 in cystic fibrosis lung disease severity and identify STAT3 as a modulating pathway. PMID: 27799352
  • Results suggest that CXCL1 is a key molecular link between senescence of stromal fibroblasts and tumor growth. PMID: 27092462
  • Increased IL-8 and CXCL1 transcription in T84 and THP-1 cells compared to that in wild-type EPEC. PMID: 27297392
  • CXCL1 signaling in the tumor microenvironment is highly responsible for repeated intravesical recurrence, disease progression, and drug resistance through enhanced invasion ability. In conclusion, disrupting CXCL1 signaling to dysregulate this chemokine is a promising therapeutic approach for human UCB. PMID: 27690238
  • Silencing of the CXCL1 gene inhibits HGC803 cell migration and invasion. The positive expression of CXCL1 is correlated with poor survival of gastric cancer patients and CXCL1 is an independent prognostic factor for gastric cancer. PMID: 27748927
  • These results demonstrate that tumor-derived CXCL1 contributes to TANs infiltration in lung cancer which promotes tumor growth. PMID: 27446967
  • the serum levels of the soluble factors sCD40L and CXCL1 are not associated with endometriosis and are not suitable as biomarkers for disease diagnosis. PMID: 27190986
  • Elevated expression of GRO-alpha in cytoplasm of cancer cells (hazard ratio [HR] = 5.730, P = 0.007) and stroma (HR = 3.120, P = 0.022) were independent prognostic factors of pancreatic cancer. T classification (HR = 2.130, P = 0.023), lymphatic metastasis (HR = 4.211, P = 0.009) and TNM classification (HR = 0.481, P = 0.031) were also prognostic predictors in PC patients. PMID: 27472713
  • The novel findings reveal the critical role of NLRP12-IL-17A-CXCL1 axis in host defense by modulating neutrophil recruitment against Klebsiella pneumoniae. PMID: 26349659
  • increased amounts released by neutrophils from fibromyalgia patients PMID: 26341115
  • these findings suggest that CXCL1 plays critical roles in the growth and apoptosis of hepatocellular carcinoma PMID: 26499374
  • BBP also stimulated the production of CXCL1/GROalpha by TADCs, which increased the angiogenesis of breast cancer in a mouse model PMID: 26397389
  • Intense glomerular CXCL1 expression was observed in biopsy specimens from patients with lupus nephritis PMID: 25471749
  • hCXCL1-GAG interactions provide stringent control over regulating chemokine levels and receptor accessibility and activation, and that chemotactic gradients mediate cellular trafficking to the target site. PMID: 26721883
  • Urine CXCL1 is a promising, non-invasive molecular marker for tumor detection and outcome prediction in patients with bladder cancer . PMID: 26406865
  • CXCR2-CXCL1 axis is correlated with neutrophil infiltration and predicts a poor prognosis in hepatocellular carcinoma PMID: 26503598
  • Polymorphisms in the promoter regions of the CXCL1 and CXCL2 genes contribute to increased risk of alopecia areata in the Korean population PMID: 26345899
  • VEGF markedly induces CXCL1 release in A549 lung epithelial cells. PMID: 23665907
  • TGF-beta negatively regulates CXCL1 expression in CAFs through Smad2/3 binding to the promoter, and through suppression of HGF/c-Met autocrine signaling PMID: 26252654
  • work shows parallel networks of necroptosis-induced CXCL1 and Mincle signalling that promote macrophage-induced adaptive immune suppression and thereby enable pancreatic ductal adenocarcinoma progression PMID: 27049944
  • High CXCL1 expression is a poor prognostic biomarker in metastatic colorectal cancer. PMID: 26104296
  • urinary CXCL1 as a new non-invasive predictor of IgAN progression PMID: 25816025
  • CXCL1 expression was a negative prognostic factor. PMID: 25175281
  • There was a significant positive correlation between CXCL-1 levels in the vitreous and the extent of the retinal detachment. PMID: 25766782
  • CXCL1 expression was highly upregulated in patients with alcoholic hepatitis. PMID: 25930080
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed