Recombinant Human Growth/Differentiation Factor 15 (GDF15) Protein (His)
Recombinant Human Growth/Differentiation Factor 15 (GDF15) Protein (His)
Collections: All products, Buy cytokines, chemokines, and growth factors for research online, Celebrate thanksgiving with 30% off all beta lifescience products!, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins, In-stock recombinant proteins
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
| Description | Recombinant Human Growth/Differentiation Factor 15 (GDF15) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q99988 |
| Target Symbol | GDF15 |
| Synonyms | GDF 15; GDF-15; Gdf15; GDF15_HUMAN; Growth differentiation factor 15; Growth/differentiation factor 15; Macrophage inhibitory cytokine 1; MIC 1; Mic-1; MIC1; NAG 1; NAG-1; NAG1; NRG 1; NRG-1; NRG1; NSAID (nonsteroidal anti inflammatory drug) activated protein 1; NSAID; NSAID regulated protein 1; NSAID-activated gene 1 protein; NSAID-regulated gene 1 protein; PDF; PLAB; Placental bone morphogenetic protein; Placental bone morphogenic protein; Placental TGF beta; Placental TGF-beta; Prostate differentiation factor; PTGF beta; PTGFB |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | RNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI |
| Expression Range | 198-308aa |
| Protein Length | Partial |
| Mol. Weight | 16.2kDa |
| Research Area | Cardiovascular |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Regulates food intake, energy expenditure and body weight in response to metabolic and toxin-induced stresses. Binds to its receptor, GFRAL, and activates GFRAL-expressing neurons localized in the area postrema and nucleus tractus solitarius of the brainstem. It then triggers the activation of neurons localized within the parabrachial nucleus and central amygdala, which constitutes part of the 'emergency circuit' that shapes feeding responses to stressful conditions. On hepatocytes, inhibits growth hormone signaling. |
| Subcellular Location | Secreted. |
| Protein Families | TGF-beta family |
| Database References |
HGNC: PMID: 28062617 |

