Recombinant Human Growth Arrest And Dna Damage-Inducible Protein Gadd45 Gamma (GADD45G) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09768P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Growth Arrest And Dna Damage-Inducible Protein Gadd45 Gamma (GADD45G) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09768P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Growth Arrest And Dna Damage-Inducible Protein Gadd45 Gamma (GADD45G) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | O95257 |
| Target Symbol | GADD45G |
| Synonyms | CR6; Cytokine responsive protein CR6; Cytokine-responsive protein CR6; DDIT-2; DDIT2; DNA damage-inducible transcript 2 protein; GA45G_HUMAN; Gadd45g; Growth arrest and DNA damage inducible gamma ; Growth arrest and DNA damage-inducible protein GADD45 gamma; GRP17 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE |
| Expression Range | 1-159aa |
| Protein Length | Full Length |
| Mol. Weight | 33.1kDa |
| Research Area | Epigenetics And Nuclear Signaling |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK. |
| Protein Families | GADD45 family |
| Database References | HGNC: 4097 OMIM: 604949 KEGG: hsa:10912 STRING: 9606.ENSP00000252506 UniGene: PMID: 27861856 |
