Recombinant Human Growth Arrest And Dna Damage-Inducible Protein Gadd45 Gamma (GADD45G) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-09768P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Growth Arrest And Dna Damage-Inducible Protein Gadd45 Gamma (GADD45G) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-09768P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Growth Arrest And Dna Damage-Inducible Protein Gadd45 Gamma (GADD45G) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb O95257
Target Symbol GADD45G
Synonyms CR6; Cytokine responsive protein CR6; Cytokine-responsive protein CR6; DDIT-2; DDIT2; DNA damage-inducible transcript 2 protein; GA45G_HUMAN; Gadd45g; Growth arrest and DNA damage inducible gamma ; Growth arrest and DNA damage-inducible protein GADD45 gamma; GRP17
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His-SUMO
Target Protein Sequence MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
Expression Range 1-159aa
Protein Length Full Length
Mol. Weight 33.1kDa
Research Area Epigenetics And Nuclear Signaling
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK.
Protein Families GADD45 family
Database References

HGNC: 4097

OMIM: 604949

KEGG: hsa:10912

STRING: 9606.ENSP00000252506

UniGene: PMID: 27861856

  • In contrast to solid tumors, in DLBCL, the frequency of GADD45gamma methylation is higher and may be associated with progression. Nodal involvement is more likely to be present in patients with unmethylated GADD45gamma. PMID: 25912017
  • PAX5 was found to be an epigenetically inactivated tumor suppressor that inhibited non-small-cell lung proliferation and metastasis, through down-regulating the beta-catenin pathway and up-regulating GADD45G expression. PMID: 26843424
  • GADD45G protein, human PMID: 26521045
  • Results establish that the dowregulation of GADD45G-SIP1 axis may contribute to cellular senescence evasion and HCC development. PMID: 26378039
  • we demonstrated that GADD45gamma expression in hepatocellular carcinoma cells was associated with sorafenib sensitivity PMID: 26172295
  • demonstrate for the first time that miR-383 can specifically regulates the expression of Gadd45g by directly targeting to the 3-UTR region of Gadd45g mRNA, a regulatory process conserved in human tumor cells and mouse embryonic stem cells PMID: 25415264
  • Expression of GADD45gamma was significantly higher in pituitary adenomas of female patients. PMID: 25126861
  • Suggest that cucurbitacin E induced mitosis delay is regulated by GADD45gamma overexpression in malignant gliomas. PMID: 24577085
  • GADD45G functions as a negative regulator of the Jak-Stat3 pathway and inhibits hepatocellular carcinoma by inducing cellular senescence. PMID: 23897841
  • The gadd45g gene has both tumor suppressor and tumor promoter functions, dependent on the tissue/cell type and transforming event. (Review) PMID: 24104471
  • Decreased expression and aberrant methylation of Gadd45G is associated with tumor progression in esophageal squamous cell carcinoma. PMID: 23793925
  • Methylation-mediated repression of GADD45G expression is associated with gastric cardia adenocarcinoma. PMID: 23616123
  • In addition, eight genes classified as 'second tier' hits in the original study (PAX7, THADA, COL8A1/FILIP1L, DCAF4L2, GADD45G, NTN1, RBFOX3 and FOXE1) showed evidence of linkage and association in this replication sample. PMID: 23512105
  • Knock-down of GADD45gamma significantly attenuates TNF-a and IL-6 production in the human monocyte-macrophage THP-1 cell line as well as in human peripheral blood mononuclear cells PMID: 22752116
  • clinically non-functioning adenomas had a significant decrease (P<0.001) in the relative levels of GADD45c expression (13 of 14 adenomas or 92%), compared to functioning adenomas (11 of 24 or 46%) PMID: 21850407
  • Data show that mda-7/IL-24 activation leads to upregulation of growth arrest and DNA damage inducible (GADD) 45 alpha and gamma and JNK activation. PMID: 21931671
  • These results reveal the mechanism of self-association by Gadd45 proteins and the importance of this self-association for their biological function PMID: 22058036
  • The induction of GADD45gamma gene expression by 1,25-(OH)2D3 may mark therapeutic response in prostate cancer. PMID: 20739400
  • Epigenetic regulation of GADD45G is associated with carcinogenesis in stomach, colorectal and pancreateic cancers. PMID: 20111973
  • Flow cytometric analysis revealed significant G2/M arrest in cells transfected with either Gadd45alpha or Gadd45gamma. Importantly, we found that expression of either Gadd45alpha or Gadd45gamma activated P38 and JNK kinase pathways to induce G2/M arrest. PMID: 19048389
  • a powerful growth suppressor controlling pituitary cell proliferation and the first identified gene whose expression is lost in the majority of human pituitary tumors. PMID: 11889197
  • results suggest that CRIF1 is a novel nuclear protein that interacts with Gadd45 and may play a role in negative regulation of cell cycle progression and cell growth PMID: 12716909
  • Data show that GADD45 gamma mRNA expression is down-regulated in hepatocellular carcinoma, and that GADD45 gamma causes cell cycle arrest at G2/M transition when transfected into Hep-G2 cells. PMID: 14672412
  • GADD45g induction by androgens requires new protein synthesis; overexpression of GADD45g inhibited cell growth and caused morphological changes in prostate cell lines, arguing that GADD45g is involved in differentiation induced by androgens PMID: 15062559
  • Inhibition of GADD45alpha and gamma in cancer cells by small interfering RNA abrogates apoptosis induction by the inhibitor of NF-kappaB PMID: 15353598
  • Results show that GADD45G can act as a functional new-age tumor suppressor but being frequently inactivated epigenetically in multiple tumors. PMID: 16166418
  • Establish MDA-7/IL-24 and GADD45alpha and GADD45gamma as critical mediators of apoptosis and growth arrest in response to NSAIDs in cancer cells. PMID: 17178890
  • Human Gadd45gamma and its selenomethionine derivative were expressed in an Escherichia coli expression system and purified; they were then crystallized using the hanging-drop vapour-diffusion method. PMID: 18997345
  • urinary GADD45gamma expression is associated with progression of renal disease PMID: 19293565
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed