Recombinant Human Growth Arrest And Dna Damage-Inducible Protein Gadd45 Alpha (GADD45A) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-09999P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Growth Arrest And Dna Damage-Inducible Protein Gadd45 Alpha (GADD45A) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-09999P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Growth Arrest And Dna Damage-Inducible Protein Gadd45 Alpha (GADD45A) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P24522
Target Symbol GADD45A
Synonyms DDIT 1; DDIT-1; DDIT1; DNA damage inducible transcript 1; DNA damage-inducible transcript 1 protein; GA45A_HUMAN; GADD45; GADD45A; Growth arrest and DNA damage inducible 45 alpha ; Growth arrest and DNA damage inducible alpha; Growth arrest and DNA damage-inducible protein GADD45 alpha
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His-SUMO
Target Protein Sequence MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
Expression Range 1-165aa
Protein Length Full Length
Mol. Weight 34.3kDa
Research Area Cell Cycle
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function In T-cells, functions as a regulator of p38 MAPKs by inhibiting p88 phosphorylation and activity. Might affect PCNA interaction with some CDK (cell division protein kinase) complexes; stimulates DNA excision repair in vitro and inhibits entry of cells into S phase.
Subcellular Location Nucleus.
Protein Families GADD45 family
Database References

HGNC: 4095

OMIM: 126335

KEGG: hsa:1647

STRING: 9606.ENSP00000360025

UniGene: PMID: 28679648

  • Findings demonstrated that miR-148a promotes glioma cell invasion and tumorigenesis by downregulating GADD45A. Findings provide novel insights into how GADD45A is downregulated by miR-148a in IDH1R132H glioma PMID: 28445981
  • A mechanism in which GADD45a is required for demethylation of the MMP-9 promoter and the induction of diabetic wound healing. The inhibition of GADD45a might be a therapeutic strategy for diabetic foot ulcers. PMID: 29244109
  • Our findings indicate that GADD45 essentially suppresses the MKK7-JNK pathway and suggest that differentially expressed GADD45 family members fine-tune stress-inducible JNK activity. PMID: 29037961
  • Stimulation of ribosomal RNA gene promoter by transcription factor Sp1 involves active DNA demethylation by Gadd45-NER pathway. PMID: 27156884
  • the enhancement of GADD45A-mediated base excision repair modulated by ATF2 might be a potential protective mechanism of visible red light. PMID: 27729279
  • Data show that growth arrest and DNA-damage-inducible 45 alpha protein (Gadd45a) expression is up-regulated in chronic phase myelocytic leukemia, chronic (CML) patient samples but down-regulated in accelerated and blast crisis phase samples. PMID: 28086219
  • These data revealed that Riboflavin plus ultraviolet (UV) pathogen reduction technology effectively inhibited proliferation and induced apoptosis of lymphocytes by promoting GADD45alpha expression, which subsequently activates p38 and JNK signaling pathways. PMID: 27905125
  • data suggest GADD45 proteins play a role in controlling HIV-1 transcription and in regulating HIV-1 latency PMID: 26994425
  • Taken together, our results suggest that ROS generation might be a predisposing event in berberine-induced mitochondrial apoptosis in EBV-transformed B cells through the upregulation of XAF1 and GADD45alpha expression by MAPK and functional p53. PMID: 27121748
  • Collective results lead us to conclude that GADD45alpha modulates curcumin sensitivity through activation of c-Abl > JNK signaling in a mismatch repair-dependent manner PMID: 26833194
  • BRCA1 may act as an important negative regulator in cell cycle progression and tumorigenesis through regulating the stability of Smad4; this defines a novel link that connects BRCA1 to TGF-beta1/Smad pathway. PMID: 26022109
  • MiR-362-5p promotes the malignancy of chronic myelocytic leukaemia via down-regulation of GADD45alpha PMID: 26545365
  • these data suggest a dual function of GADD45a in oxidative DNA demethylation, to promote directly or indirectly TET1 activity and to enhance subsequent 5-formylcytosine/5-carboxylcytosine removal. PMID: 26546041
  • These data suggest that GADD45A (1506T>C) is a new tumor susceptibility gene and could be a useful molecular marker for assessing ovarian cancer risk and for predicting ovarian cancer patient prognosis. PMID: 26422378
  • Data show that heterogeneous nuclear ribonucleoprotein A0 (hnRNPA0) drives chemo-resistance of p53-mutant tumor cells via p27Kip1/Gadd45alpha mRNAs. PMID: 26602816
  • GADD45A mRNA expression was significantly greater in patients with SLE compared to controls. PMID: 25899090
  • Report GADD45alpha luciferase reporter assays in human cells for assessing the genotoxicity of environmental pollutants. PMID: 25560476
  • Data showed that upregulation of cytoplasmic AFP is associated with down-regulation of GADD45a in hepatocellular neoplastic tissues and that AFP mediated downregulation of GADD45a to accelerate aberrant growth of HBV infected cells. PMID: 25846475
  • Serum GADD45a methylation in combination with PSA and fcDNA level was useful in distinguishing benign from prostate cancer patients. PMID: 26171936
  • GADD45a promoter regulation by a functional genetic variant is associated with acute mechanical lung injury. PMID: 24940746
  • Induction of GADD45alpha protects M17 neuroblastoma cells against MPP+. PMID: 25469469
  • Knockdown of Gadd45a gene abolished the G2/M arrest. PMID: 25450267
  • High GADD45A expression is associated with response to low intravenous immunoglobulin therapy in patients with Kawasaki disease. PMID: 25449331
  • results for the first time demonstrate that nucleolin-SUMO at K294R plays a critical role in its nucleus sequestration and gadd45alpha mRNA binding activity. PMID: 25561743
  • Individuals carrying the GADD45Ars532446 genotype were at higher risk for chromosomal damage compared with the wild type genotype. PMID: 24464562
  • DNA damage-inducible transcript 1 protein(Gadd45alpha) may be involved in human trophoblast migration and invasion and may function as an important negative regulator at the foetal-maternal interface during early pregnancy PMID: 24755561
  • Results show TARID binds to the TCF21 promoter and recruits GADD45A and TDG to direct base excision repair for demethylation. PMID: 25087872
  • the present results revealed, for the first time, that Hes-1 could be SUMO-modified by PIAS1 and GADD45alpha is a novel target of Hes-1 PMID: 24894488
  • Expression of cell cycle regulatory factors hus1, gadd45a, rb1, cdkn2a and mre11a correlates with expression of clock gene per2 in human colorectal carcinoma tissue. PMID: 24062075
  • we conclude that repair, together with Gadd45 and MDM2 genes, were involved in light and dark reaction mechanisms. PMID: 24177565
  • the promotion of base excision repair activity by a p53-dependent pathway is mediated by an interaction between Gadd45a, PCNA and APE1 in the presence of organic selenium that results in increased APE1 activity PMID: 23846616
  • Gadd45a, encodes a ubiquitously expressed protein that is often induced by DNA damage and other stress signals associated with growth arrest and apoptosis. (Review) PMID: 24104470
  • The gadd45a gene has both tumor suppressor and tumor promoter functions, dependent on the tissue/cell type and transforming event. (Review) PMID: 24104471
  • The Gadd45A protein is a stress sensor in preeclampsia. PMID: 24104476
  • Gadd45a levels are significantly associated with hormone receptor status in human breast cancer PMID: 23706118
  • The absolute mRNA content of paraffin embedded samples of salivary gland cancer was determined by quantitative reverse transcription-PCR using specific primers for NFkB1, GADD45A and JNK1. PMID: 23603344
  • Methylation-mediated repression of GADD45A expression is associated with gastric cardia adenocarcinoma. PMID: 23616123
  • Data indicate that salivary gland epithelial cells (SGEC) demethylation in Sjogren's syndrome (SS)patients was associated with a 7-fold decrease in DNA methyl transferase DNMT1 and a 2-fold increase in Gadd45-alpha expression. PMID: 23478041
  • GADD45A hyper-methylation may be detecting a broader epigenetic phenotype in acute myeloid leukemia. PMID: 23187294
  • The expressions of p21(Cip1/WAF1), Gadd45alpha and p53 are associated with the clinicopathologic features and prognosis in breast cancer. PMID: 23158659
  • Proliferating cell nuclear antigen (PCNA) binding site on Gadd45alpha plays a critical role in modulating the interaction with PCNA and APE1, affecting base excision repair. PMID: 23485469
  • reduced Gadd45alpha protein expression by forced miR-499 expression indicated it's a diabetes-associated gene which might potentially be involved in both DCM and DM-induced baroreflex dysfunction PMID: 23227140
  • The expression of Gadd45a in normal, developing brain is tightly regulated. PMID: 22970179
  • To examine the functions of Gadd45a in cell invasion and metastasis, we performed the adhesion, wound-healing and transwell assays in Gadd45a (+/+) and Gadd45a (-/-) MEF cell lines. PMID: 22825327
  • Hepatitis C virus NS5A repressed p53 expression, which was followed by a subsequent decrease in GADD45alpha expression, which triggered cellular proliferation. PMID: 23114628
  • The induction of Gadd45a in response to preeclampsia stresses was associated with the activation of its downstream effectors phospho-p38 and phospho-JNK. Soluble Flt-1 levels were subsequently regulated through one of these effectors, but not both. PMID: 22718299
  • the effect of APRIL is mediated via BCMA, which does not activate the classical NF-kappaB pathway, whereas it induces a novel signaling pathway, which involves JNK2 phosphorylation, FOXO3A activation, and GADD45 transcription PMID: 23071284
  • Estrogen receptor beta causes a G2 cell cycle arrest by inactivating CDK1 through the repression of cyclin B1 and stimulation of GADD45A and BTG2 expression. PMID: 21120602
  • [review] Decreased inducibility of Gadd45 members has far-reaching consequences including genome instability, DNA damage, and disorders in cellular homeostasis, which contribute to the aging process and age-related disorders. PMID: 21986581
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed