Recombinant Human Group Iid Secretory Phospholipase A2 (PLA2G2D) Protein (His-SUMO)

Name: Recombinant Human Group Iid Secretory Phospholipase A2 (PLA2G2D) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-04322P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Group Iid Secretory Phospholipase A2 (PLA2G2D) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q9UNK4
Target Symbol	PLA2G2D
Synonyms	2IID; EC 3.1.1.4; GIID sPLA2; Group IID secretory phospholipase A2; Group IID secretory phospholipase A2 precursor ; PA2GD_HUMAN; Phosphatidylcholine 2 acylhydrolase GIID; Phosphatidylcholine 2-acylhydrolase 2D; Phospholipase A2 group IID ; Pla2g2d; PLA2IID; Secretory phospholipase A2s; Secretory type PLA stroma associated homolog; Secretory-type PLA; sPLA ; sPLA2-IID; sPLA2S ; SPLASH ; stroma-associated homolog
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	ILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC
Expression Range	22-145aa
Protein Length	Partial
Mol. Weight	30.5kDa
Research Area	Metabolism
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Secretory calcium-dependent phospholipase A2 that primarily targets extracellular lipids, exerting anti-inflammatory and immunosuppressive functions. Hydrolyzes the ester bond of the fatty acyl group attached at sn-2 position of phospholipids (phospholipase A2 activity) with preference for phosphatidylethanolamines and phosphatidylglycerols over phosphatidylcholines. In draining lymph nodes, selectively hydrolyzes diacyl and alkenyl forms of phosphatidylethanolamines, releasing omega-3 polyunsaturated fatty acids (PUFAs) such as eicosapentaenoate and docosahexaenoate that are precursors of the anti-inflammatory lipid mediators, resolvins. During the resolution phase of acute inflammation drives docosahexaenoate-derived resolvin D1 synthesis, which suppresses dendritic cell activation and T-helper 1 immune response. May act in an autocrine and paracrine manner. Via a mechanism independent of its catalytic activity, promotes differentiation of regulatory T cells (Tregs) and participates in the maintenance of immune tolerance. May contribute to lipid remodeling of cellular membranes and generation of lipid mediators involved in pathogen clearance. Displays bactericidal activity against Gram-positive bacteria by directly hydrolyzing phospholipids of the bacterial membrane.
Subcellular Location	Secreted.
Protein Families	Phospholipase A2 family
Database References	HGNC: 9033 OMIM: 605630 KEGG: hsa:26279 STRING: 9606.ENSP00000364246 UniGene: PMID: 26392224 sPLA(2)-IID is present at the head and midpiece in the human sperm, and its activation seems to be involved in acrosomal exocytosis. PMID: 22240557 phospholipid bilayer permeabilization by the hsPLA2GIID is independent of catalytic activity. PMID: 22490726 The Gly80Ser polymorphism may be associated with the body weight loss seen in chronic obstructive pulmonary disease patients. PLA2G2D-Ser enhances the expression of IL-6 and IL-8 compared with PLA2G2D-Gly. PMID: 19365107 TNF-alpha & IFN-gamma induce gene expression of a novel secretory PLA(2)IIDin human airway epithelial cells. The possibility that it is involved in cytokine-mediated inflammation in the respiratory tract is inferred. PMID: 12396716 The GIID sPLA2 is clustered on human chromosome 1 and is differentially expressed in tissues, suggesting it has unique function. PMID: 15052324 overexpression of human secretory phospholipase A2 group IIA leads to an enhanced delivery of cholesterol from phospholipolysed lipoproteins to the liver PMID: 15379211 These results suggest that sPLA2-IID may be one of the susceptibility genes that contribute to body weight loss in patients with COPD. PMID: 16002569 lipopolysaccharides inhibit interferon gamma-induced gene expression of secretory phospholipase A2 type IID in human monocyte-derived macrophages PMID: 16897354 The distribution pattern of sPLA2S in intact spermatozoa might be an additional parameter for evaluating sperm quality PMID: 18958346

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.