Recombinant Human Group Iid Secretory Phospholipase A2 (PLA2G2D) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04322P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Group Iid Secretory Phospholipase A2 (PLA2G2D) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04322P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Group Iid Secretory Phospholipase A2 (PLA2G2D) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q9UNK4 |
| Target Symbol | PLA2G2D |
| Synonyms | 2IID; EC 3.1.1.4; GIID sPLA2; Group IID secretory phospholipase A2; Group IID secretory phospholipase A2 precursor ; PA2GD_HUMAN; Phosphatidylcholine 2 acylhydrolase GIID; Phosphatidylcholine 2-acylhydrolase 2D; Phospholipase A2 group IID ; Pla2g2d; PLA2IID; Secretory phospholipase A2s; Secretory type PLA stroma associated homolog; Secretory-type PLA; sPLA ; sPLA2-IID; sPLA2S ; SPLASH ; stroma-associated homolog |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | ILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC |
| Expression Range | 22-145aa |
| Protein Length | Partial |
| Mol. Weight | 30.5kDa |
| Research Area | Metabolism |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Secretory calcium-dependent phospholipase A2 that primarily targets extracellular lipids, exerting anti-inflammatory and immunosuppressive functions. Hydrolyzes the ester bond of the fatty acyl group attached at sn-2 position of phospholipids (phospholipase A2 activity) with preference for phosphatidylethanolamines and phosphatidylglycerols over phosphatidylcholines. In draining lymph nodes, selectively hydrolyzes diacyl and alkenyl forms of phosphatidylethanolamines, releasing omega-3 polyunsaturated fatty acids (PUFAs) such as eicosapentaenoate and docosahexaenoate that are precursors of the anti-inflammatory lipid mediators, resolvins. During the resolution phase of acute inflammation drives docosahexaenoate-derived resolvin D1 synthesis, which suppresses dendritic cell activation and T-helper 1 immune response. May act in an autocrine and paracrine manner. Via a mechanism independent of its catalytic activity, promotes differentiation of regulatory T cells (Tregs) and participates in the maintenance of immune tolerance. May contribute to lipid remodeling of cellular membranes and generation of lipid mediators involved in pathogen clearance. Displays bactericidal activity against Gram-positive bacteria by directly hydrolyzing phospholipids of the bacterial membrane. |
| Subcellular Location | Secreted. |
| Protein Families | Phospholipase A2 family |
| Database References | HGNC: 9033 OMIM: 605630 KEGG: hsa:26279 STRING: 9606.ENSP00000364246 UniGene: PMID: 26392224 |
