Recombinant Human Granzyme B (GZMB) Protein (His-B2M)
Beta LifeScience
SKU/CAT #: BLC-07587P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Granzyme B (GZMB) Protein (His-B2M)
Beta LifeScience
SKU/CAT #: BLC-07587P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Granzyme B (GZMB) Protein (His-B2M) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P10144 |
| Target Symbol | GZMB |
| Synonyms | (C11)(CTLA-1)(Cathepsin G-like 1)(CTSGL1)(Cytotoxic T-lymphocyte proteinase 2)(Lymphocyte protease)(Fragmentin-2)(Granzyme-2)(Human lymphocyte protein)(HLP)(SECT)(T-cell serine protease 1-3E) |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-B2M |
| Target Protein Sequence | IIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY |
| Expression Range | 21-247aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 39.5 kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Abundant protease in the cytosolic granules of cytotoxic T-cells and NK-cells which activates caspase-independent pyroptosis when delivered into the target cell through the immunological synapse. It cleaves after Asp. Once delivered into the target cell, acts by catalyzing cleavage of gasdermin-E (GSDME), releasing the pore-forming moiety of GSDME, thereby triggering pyroptosis and target cell death. Seems to be linked to an activation cascade of caspases (aspartate-specific cysteine proteases) responsible for apoptosis execution. Cleaves caspase-3, -7, -9 and 10 to give rise to active enzymes mediating apoptosis. |
| Subcellular Location | Secreted. Cytolytic granule. |
| Protein Families | Peptidase S1 family, Granzyme subfamily |
| Database References | HGNC: 4709 OMIM: 123910 KEGG: hsa:3002 STRING: 9606.ENSP00000216341 UniGene: PMID: 29319368 |
