Recombinant Human Golgi Phosphoprotein 3 (GOLPH3) Protein (His)

Name: Recombinant Human Golgi Phosphoprotein 3 (GOLPH3) Protein (His)
Brand: Beta LifeScience
SKU: BLC-01978P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Golgi Phosphoprotein 3 (GOLPH3) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q9H4A6
Target Symbol	GOLPH3
Synonyms	Coat protein GPP34 (Mitochondrial DNA absence factor) (MIDAS)
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK
Expression Range	1-298aa
Protein Length	Full Length
Mol. Weight	39.8 kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Phosphatidylinositol-4-phosphate-binding protein that links Golgi membranes to the cytoskeleton and may participate in the tensile force required for vesicle budding from the Golgi. Thereby, may play a role in Golgi membrane trafficking and could indirectly give its flattened shape to the Golgi apparatus. May also bind to the coatomer to regulate Golgi membrane trafficking. May play a role in anterograde transport from the Golgi to the plasma membrane and regulate secretion. Has also been involved in the control of the localization of Golgi enzymes through interaction with their cytoplasmic part. May play an indirect role in cell migration. Has also been involved in the modulation of mTOR signaling. May also be involved in the regulation of mitochondrial lipids biosynthesis.
Subcellular Location	Golgi apparatus, Golgi stack membrane; Peripheral membrane protein; Cytoplasmic side. Golgi apparatus, trans-Golgi network membrane; Peripheral membrane protein; Cytoplasmic side. Mitochondrion intermembrane space. Cell membrane. Endosome.
Protein Families	GOLPH3/VPS74 family
Database References	HGNC: 15452 OMIM: 612207 KEGG: hsa:64083 STRING: 9606.ENSP00000265070 UniGene: PMID: 30015866 High GOLPH3 expression is associated with breast cancer. PMID: 29534690 This study provides a brand new evidence that GOLPH3 promotes glioma cell proliferation by facilitating Wls recycling and Wnt/beta-catenin signaling. PMID: 29990993 High GOLPH3 expression is associated with glioma progression. PMID: 28575494 Proteomic-based screens identified GOLPH3 as a resident protein of the Golgi apparatus, and second as an oncogene product in a screen for genes amplified in cancer. A third screen uncovered the association of GOLPH3 with the Golgi resident phosphatidyl inositol 4 phosphate to maintain the characteristic ribbon structure of the Golgi apparatus favoring vesicular transport of secretory proteins. [review] PMID: 28954815 Overexpression of GOLPH3 resulted in the downregulation of p21 protein, upregulation of cyclin D1 and increased retinoblastomaassociated protein phosphorylation, consequently leading to accelerated cell cycle progression. PMID: 28901498 Results indicate that GOLPH3 is an independent predictive factor for neoadjuvant chemoradiotherapy (nCRT) sensitivity and prognosis in locally advanced rectal cancer (LARC). PMID: 27634904 Results provide evidences that overexpression of GOLPH3 stimulates EMT via the Wnt/beta-catenin signaling pathway, which further promotes metastasis of epithelial ovarian cancer. PMID: 28332316 GOLPH3 levels may be a novel prognostic biomarker of tobacco related lung disease. PMID: 27611309 Authors confirm that the decrease of GOLPH3 that promotes the apoptosis of glioma cells may be regulated by the activation of NDRG1 and cleaved capcase 3. There was a inverse association between GOLPH3 and NDRG1 in glioma samples. PMID: 27698340 Data found that miR-134 was highly downregulated in gastric cancer tissues and cell lines and inversely correlated with GOLPH3. These results suggest that miR-134 regulates gastric cancer cell proliferation, at least potentially, through downregulation of the GOLPH3 gene, implicating a candidate tumor-suppressor miRNA in the pathogenesis of gastric cancer. PMID: 28260021 In this review, we will explore the cellular functions regulated by GOLPH3 and discuss if and how they contribute to the oncogenic activity of this intriguing Golgi localized oncoprotein. PMID: 27378035 cumulative evidence indicates that GOLPH3 participates in several cellular processes critical for cancer cells, emerging as an attractive therapeutic target PMID: 27123979 GOLPH3 overexpression may participate in the occurrence and development of colorectal carcinoma by inhibiting apoptosis and promoting angiogenesis. PMID: 26730158 Results show that high GOLPH3 and nuclear/cytoplasmic YB-1 expression correlated with a poor prognosis in patients with prostate cancer. PMID: 26794392 Review/Meta-analysis: overexpression of GOLPH3 predicts poor prognosis in solid tumors. PMID: 26617771 GOLPH3 is likely to play important roles in bladder cancer progression via modulating AKT/mTOR signaling, and it is a novel prognostic biomarker and promising therapeutic target for bladder cancer. PMID: 26375441 GOLPH3 was expressed in prostate cancer cell lines. Our findings suggest GOLPH3 regulate MMP9 expression which impact cell migration and invasion. PMID: 26097550 GOLPH3 promotes glioblastoma cell migration and invasion via the mTOR-YB1pathway. PMID: 25156912 GOLPH3 expression predicts poor prognosis in patients with prostate cancer undergoing radical prostatectomy. PMID: 25760033 High GOLPH3 expression is associated with poor prognosis and invasion of hepatocellular carcinoma PMID: 25634514 The expression level of GOLPH3 is correlated with metastasis and prognosis in NSCLC, and GOLPH3 mediates metastasis by regulating the protein levels of MMP-2 and MMP-9 in vitro. PMID: 25659977 Results show that in esophageal squamous cell carcinoma (ESCC), miR-126 was downregulated and IRS-1 and GOLPH3, overexpressed suggesting a tumor suppression role of miR-126 via the regulation of IRS-1 and GOLPH3. PMID: 25017784 High expression of the GOLPH3 protein is common in early-stage Non-Small-Cell Lung Carcinoma, and is closely associated with tumor progression, increased tumor angiogenesis, and poor survival. PMID: 25081702 The GOPLH3 expression level is highly correlated with Akt/mTOR signaling in human gastric cancer samples. PMID: 25286393 High GOLPH3 expression is associated with metastasis in non-small cell lung cancer. PMID: 25081375 Our recent investigation of the regulation of GOLPH3 revealed a surprising response by the Golgi upon DNA damage that is mediated by DNA-PK and GOLPH3. PMID: 25634214 Study demonstrated that overexpression of GOLPH3 was associated with poor survival in patients with pancreatic ductal adenocarcinoma. PMID: 25104140 The DNA copy number variations disrupt PDZD2 and GOLPH3 genes predominantly expressed in placenta, and it may represent a novel risk factor for recurrent miscarriage. PMID: 24827138 overexpression of GOLPH3 protein is closely related to poorer prognosis in patients with epithelial ovarian cancer. PMID: 25204671 Golgi phosphoprotein 3 (GOLPH3) promotes hepatocellular carcinoma cell aggressiveness by activating the NF-kappaB pathway. PMID: 25385148 These results are the first direct demonstration of the role of GOLPH3 in N-glycosylation to regulate cell biological functions. PMID: 24895123 In this review, GOLPH3 is described as an oncoprotein involved in cell signal transduction. PMID: 24395131 GOLPH3 has a role in triggering signal-mediated incorporation of glycosyltransferases into coatomer-coated vesicles PMID: 25246532 Data indicate that Golgi phosphoprotein 3 (GOLPH3) was overexpressed in hepatocellular carcinoma (HCC) at both the mRNA and protein levels, and high expression of GOLPH3 could be served as a novel and potential prognostic biomarker for HCC patients. PMID: 24867097 Both PKD2 and GOLPH3 play important roles in the progression of human gliomas by promoting cell proliferation. PMID: 25218347 GOLPH3 is associated with prognosis in colorectal cancer patients treated with postoperative 5-fluorouracil-based adjuvant chemotherapy. PMID: 24444035 These results suggest that GOLPH3 expression is likely to have important roles in renal cell carcinoma (RCC) development and progression, and that GOLPH3 is a prognostic biomarker and a promising therapeutic target for RCC. PMID: 24595000 High GOLPH3 expression is associated growth and metastasis of esophageal squamous cancer. PMID: 24175832 GOLPH3 gene expression might play a role in tumorigenesis in epithelial ovarian carcinoma as upregulation of GOLPH3 expression is associated with a more aggressive tumor phenotype. PMID: 24458516 Identification of the DNA-damage-induced Golgi response reveals an unexpected pathway through DNA-PK, GOLPH3, and MYO18A that regulates cell survival following DNA damage. PMID: 24485452 PDZ module mediates direct binding of myosin-18A to GOLPH3, and this interaction in turn modulates the actin binding properties of the N-terminal extension. Thus, myosin-18A can act as an actin cross-linker with multiple regulatory modulators PMID: 23990465 GOLPH3 regulates the migration and invasion of glioma cells though regulation of RhoA. PMID: 23500462 Overexpression of Golgi phosphoprotein-3 is associated with glioblastoma multiforme. PMID: 22972189 Data indicate the potential involvement of GOLPH3 in the development, differentiation, and tumorigenesis of esophageal squamous cell cancer (ESCC), and suggest the possibility of its use as a diagnostic and prognostic marker in ESCC. PMID: 23056210 the overexpression of GOLPH3 is closely related to the progression of gastric cancer and might be regarded as an independent predictor of poor prognosis for gastric cancer PMID: 23132295 Overexpression of GOLPH3 is associated with the transition of prostate cancer from hormone sensitive phase to hormone refractory phase. PMID: 23006319 results suggest GOLPH3 overexpression is associated with poor prognosis for cN0 oral tongue cancer patients and may represent a novel and useful prognostic indicator for cN0 oral tongue cancer PMID: 22905766 GOLPH3 can regulate cell-cell interaction by controlling Golgi retention of C2GnT1. PMID: 23027862 Data indicate that golgi phosphoprotein 3 (GOLPH3) overexpression decreased FOXO1 transcriptional activity. PMID: 22675169

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.