Recombinant Human Golgi Membrane Protein 1 (GOLM1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03576P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Golgi Membrane Protein 1 (GOLM1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03576P
Collections: High-quality recombinant proteins, Other recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Golgi Membrane Protein 1 (GOLM1) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q8NBJ4 |
Target Symbol | GOLM1 |
Synonyms | bA379P1.3; C9orf155; Chromosome 9 open reading frame 155; Golgi membrane protein 1; Golgi membrane protein GP73; Golgi phosphoprotein 2; Golgi protein 73 kD ; Golgi protein 73kD ; GOLM 1; GOLM1; GOLM1_HUMAN; GOLPH 2; GOLPH2; GP 73; GP73; PSEC0257 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL |
Expression Range | 36-401aa |
Protein Length | Partial |
Mol. Weight | 45.6kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Unknown. Cellular response protein to viral infection. |
Subcellular Location | Golgi apparatus, cis-Golgi network membrane; Single-pass type II membrane protein. Note=Early Golgi. Cycles via the cell surface and endosomes upon lumenal pH disruption. |
Protein Families | GOLM1/CASC4 family |
Database References | HGNC: 15451 OMIM: 606804 KEGG: hsa:51280 STRING: 9606.ENSP00000373363 UniGene: PMID: 29181846 |