Recombinant Human Glycodelin (PAEP) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-02819P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Glycodelin (PAEP) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-02819P
Collections: High-quality recombinant proteins, Other recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Glycodelin (PAEP) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P09466 |
Target Symbol | PAEP |
Synonyms | Alpha uterine protein; gD; GdA; GdF; GdS; Glycodelin A; Glycodelin; Glycodelin F; Glycodelin S; MGC138509; MGC142288; PAEG; PAEP; PAEP_HUMAN; PEG; PEP; Placental Protein 14 / Glycodelin A; Placental protein 14; PP14; Pregnancy-associated endometrial alpha-2 globulin; Progestagen-associated endometrial protein; Progesterone-associated endometrial protein |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-10His |
Target Protein Sequence | MDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF |
Expression Range | 19-180aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 22.4kDa |
Research Area | Tags & Cell Markers |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Glycoprotein that regulates critical steps during fertilization and also has immunomonomodulatory effects. Four glycoforms, namely glycodelin-S, -A, -F and -C have been identified in reproductive tissues that differ in glycosylation and biological activity. Glycodelin-A has contraceptive and immunosuppressive activities. Glycodelin-C stimulates binding of spermatozoa to the zona pellucida. Glycodelin-F inhibits spermatozoa-zona pellucida binding and significantly suppresses progesterone-induced acrosome reaction of spermatozoa. Glycodelin-S in seminal plasma maintains the uncapacitated state of human spermatozoa. |
Subcellular Location | Secreted. |
Protein Families | Calycin superfamily, Lipocalin family |
Database References | HGNC: 8573 OMIM: 173310 KEGG: hsa:5047 STRING: 9606.ENSP00000277508 UniGene: PMID: 28738719 |