Recombinant Human Glutathione S-Transferase P (GSTP1) Protein (His)

Beta LifeScience SKU/CAT #: BLC-05197P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Glutathione S-Transferase P (GSTP1) Protein (His)

Beta LifeScience SKU/CAT #: BLC-05197P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Glutathione S-Transferase P (GSTP1) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P09211
Target Symbol GSTP1
Synonyms Deafness; Deafness X-linked 7; DFN7; FAEES3; Fatty Acid Ethyl Ester Synthase III ; Glutathione S Transferase 3; Glutathione S Transferase Pi; Glutathione S-transferase P; Glutathione S-transferase pi 1; GST class-pi; GST3; GSTP; Gstp1; GSTP1-1; GSTP1_HUMAN; PI; X linked 7
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His
Target Protein Sequence PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Expression Range 2-210aa
Protein Length Full Length of Mature Protein
Mol. Weight 27.2kDa
Research Area Metabolism
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2). Participates in the formation of novel hepoxilin regioisomers. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration.
Subcellular Location Cytoplasm. Mitochondrion. Nucleus. Note=The 83 N-terminal amino acids function as un uncleaved transit peptide, and arginine residues within it are crucial for mitochondrial localization.
Protein Families GST superfamily, Pi family
Database References

HGNC: 4638

OMIM: 134660

KEGG: hsa:2950

STRING: 9606.ENSP00000381607

UniGene: PMID: 30043549

  • Methylation GSTP1 is associated with Breast Cancer. PMID: 30049201
  • Prenatal fine particulate exposure in late pregnancy was associated with impaired childhood lung function and hypermethylation of GSTP1 in nasal epithelium. PMID: 29703190
  • The study revealed association of GSTP1 I105V with Infectious Endocarditis, but the disease proved unrelated to GSTP1 A114V polymorphism. PMID: 30289676
  • The results of this meta-analysis suggest that GSTP1 hypermethylation induces the inactivation of GSTP1 gene, plays an important role in hepatocarcinogenesis, and is associated with an increased risk of HCC. PMID: 29970711
  • The expression levels of LRP and GSTP1 in primary epithelial ovarian cancer were the highest, followed by borderline adenoma tissues, and lowest levels in benign tumor tissues. The difference between resistant gene negative-expression and positive-expression of chemotherapy efficiency, disease free survival time, and recurrence time were statistically significant. PMID: 30313031
  • polymorphisms do not have any large effect on risk of cutaneous malignant melanoma [meta-analysis] PMID: 27304781
  • Design and synthesis of 2-substituted-5-(4-trifluoromethylphenyl-sulphonamido)benzoxazole derivatives as human GST P1-1 inhibitors. PMID: 28503938
  • The present study findings provide the insights that miR133b reduces cisplatin resistance and its overexpression contributes to the suppression of the malignant growth and aggressiveness of cisplatinresistant nonsmall cell lung cancer cells by targeting GSTP1. PMID: 29328427
  • Through translational prospective study, the GSTP1 Ile105Val polymorphism emerges as prognostic marker in de novo large B-cell lymphoma patients. PMID: 28452985
  • GSTP1 polymorphism is associated with Cervical Cancer in Human Papilloma Virus Infected patients. PMID: 29479986
  • GSTP1 Ile105Val was associated with increased lung function, reduced risk for lung cancer and tobacco-related cancer, and reduced all-cause mortality in the general population. PMID: 28739440
  • the recessive model of GSTP1 g.313A>G is the best fit inheritance model to predict the susceptible gene effect (OR: 2.3, 95% CI: 1.11-4.92, P = 0.020). In conclusion, statistically significant associations of GSTP1 g.313A>G (A/G, G/G) and g.341C>T (C/T) genotypes with coronary artery disease were observed. PMID: 29321351
  • The GSTP1 AG genotype of Alzheimer's disease was significantly lower (p = 0.005; OR = 0.57, 95% CI: 0.38-0.84) in the patients (41.1%) than the control group (56.5%). PMID: 29072550
  • Study provides evidence that high expression of CLDN6 confers chemoresistance on breast cancer which is mediated by GSTP1, the activity of which is regulated by p53. PMID: 29116019
  • Patients with CYP2C19*2 were at increased risk and CYP2C19*2, CYP3A5*3 and GSTP1 have synergistic influence on CYC failure. PMID: 28976264
  • CML patients with carriage of heterozygous and homozygous variant genotypes of GSTP1 Ile105Val and GSTT1 null, have a higher risk for development of resistance to IM. PMID: 28947711
  • the GSTP1 Ile105Val polymorphism is not associated with the development of gynecological cancer (meta-analysis). PMID: 28410197
  • DNA sequencing was performed for six single-nucleotide polymorphisms in the GSTP1, RAD51, XRCC1 and XRCC3 genes in BC patients and the control group. Two variants in the 5'-UTR of the XRCC3 and RAD51 genes showed a significant association with susceptibility to breast cancer. Additionally, authors reported 2 mutations in intron 7 of the XRCC3 gene. PMID: 28315507
  • The SNPs in CYP1A1, GSTP1 and XRCC1 genes did not show significant association with complete remission (CR) rate, overall survival (OS) or event free survival (EFS). However, XRCC1 Arg194Trp SNP was associated with higher drug toxicity; carriers of variant genotypes (CT and TT) had a significantly higher frequency of myelosuppression compared to those with the wild CC genotype PMID: 28844589
  • There were significant differences in GSTP1 (rs1138272 and rs1695) genotype or allele frequencies between the infertile and fertile groups and synergy effects of GSTP1 and NAT2 polymorphisms might lead to significant increase of infertility risk. PMID: 29505746
  • Significantly higher frequency of the GSTP1 polymorphism was observed in Extremely Low Birth Weight Preterm Infants with Bronchopulmonary Dysplasia. PMID: 28081574
  • Polymorphisms of GSTP1 rs1695 and ABCC2 rs717620 can be used to predict the outcomes of Uygur patients with advanced NSCLC who have received platinum-based chemotherapy. Kaplan-Meier survival analysis indicated that survival with GSTP1 AG+ GG was significantly longer than in patients with AA gene (P<0.05), and survival with ABCC2 CT + TT was significantly longer than in patients with CC gene. PMID: 28442702
  • GSTpi inhibited p38MAPK phosphorylation by directly binding p38 and influenced downstream substrate HSP27-induced actin remodeling. PMID: 29402793
  • the GSTP1 gene polymorphism may play a significant role in the increase of susceptibility of obesity and contribute to identify the cardiovascular risk in young adults. PMID: 28561194
  • These observations could support the hypothesis that the GSTP1 G allele may improve exercise performance by better elimination of exercise-induced reactive oxygen species. PMID: 28062686
  • This study demonstrates that the GSTP1*B and *C allelic variants may be considered a candidate gene for AD[Alzheimer disease]. It can be suggested that although CYP2D6*4 polymorphism is not a risk of AD[Alzheimer disease], the CYP2D6*4 and GSTP1 polymorphism may interact with beta-HCH, dieldrin, and copper to influence the risk of AD [Alzheimer disease]. PMID: 24584466
  • Comparing to controls, significant association with asthma was observed for GSTP1 rs1695 AA genotype PMID: 27561723
  • Peroxidase activity was markedly reduced by mutation at either of the Leu sites and was essentially abolished by the double mutation, while PLA2 activity was unaffected. Decreased peroxidase activity following mutation of the interfacial leucines presumably is mediated via impaired heterodimerization of Prdx6 with piGST that is required for reduction and re-activation of the oxidized enzyme. PMID: 26891882
  • Epigenetic alteration of GSTP1 regulates its expression in lens epithelial and cortical tissues. These changes likely contribute to the pathogenesis of ARNC. PMID: 27348130
  • GSTP1 rs1695 polymorphism was associated with higher susceptibility to the development of cervical lesions in HR-HPV-infected women. PMID: 28829907
  • We report that patients who were homozygous for the ancestral allele of the GTSP1 SNP rs1695 had a greater decline in lung function at 1 year after stem cell transplantation compared to those who had at least one minor allele of the GTSP1 SNP rs1695. PMID: 28152281
  • Single nucleotide polymorphisms in EPHX1, GSTP1, SERPINE2, and TGFB1 contributing to the quantitative traits of chronic obstructive pulmonary disease in Chinese Han population. PMID: 27193053
  • polymorphisms of the GSTM1 del and GSTT1 del genes were analysed by multiplex PCR. Genotyping of the polymorphic variants in the GSTP1 (A313G, T341C) gene was performed using Real-time PCR with competing TaqMan probes complementary to the polymorphic DNA sites PMID: 28770368
  • genetic or pharmacological inactivation of GSTP1 impairs cell survival and tumorigenesis in TNBC cells; GSTP1 inhibitors may be a novel therapeutic strategy for combatting TNBCs through impairing key cancer metabolism and signaling pathways PMID: 27185638
  • Wild-type GSTP1 allele when combined with LOH/MSI in steroid metabolism genes may play a role in ER and/or PR negative breast cancers. PMID: 28692125
  • meta-analysis suggests that the GSTP1 Ile105Val polymorphism might not contribute to risk of male infertility PMID: 28397729
  • GTSP1 was expressed in tumors of HNSCC patients regardless of smoking, drinking or HPV infection status. GTSP1 expression was higher in the non-tumor margins of smoker/drinker group. PMID: 28817620
  • there is a significant implication of the SNP rs1695 within the GSTP1 gene with ALL of Jordanian Arab children. PMID: 27299594
  • RASSF10 functions as a tumor suppressor by cooperating with GSTP1 to deregulate JNK/c-Jun/AP-1 pathway in gastric cancer PMID: 26279301
  • GSTP1 gene polymorphisms were not associated with the acquisition of hepatotoxicity in HIV patients treated with antiretroviral therapy. PMID: 26667829
  • Individuals carrying theGSTP1 Ile-Ile or XRCC1399 Arg-Arg genotypes showed greater DNA damage than observed for other alleles. PMID: 28622826
  • the significance of GSTP1 polymorphisms on Chronic myeloid leukemia susceptibility and response to tyrosine kinase inhibitors in the Argentinean population PMID: 27454607
  • Meta-analysis found that GSTP1 showed a trend toward a worse prognosis in overall survival in patients with breast cancer. PMID: 28700487
  • This is the first study to suggest that GSTP1 genotyping can be an important tool for identifying patients who are susceptible to Anti-tuberculosis drug-induced hepatotoxicity. PMID: 27281183
  • GSTP1-1 can detoxify arsenic-based drugs by sequestration at the active site and at the dimer interface, in situations where there is a plentiful supply of GSH, and at the reactive cysteines in conditions of low GSH. PMID: 27863446
  • Patients carrying at least one GSTP1 Val allele achieved remission in a shorter time period than patients with GSTP1 Ile/Ile genotype. PMID: 28039708
  • Our study indicates that GSTP1 shows aberrant methylation pattern in the breast cancer with the consequent loss in the protein expression. PMID: 28443466
  • Overexpression of GSTP1 is associated with pancreatic Cancer. PMID: 27872191
  • The rs614080 SNP near the GSTP1 gene was significantly associated with body mass index and GSTP1 expression levels in the Mexican population. PMID: 27881840
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed