Recombinant Human Glutathione S-Transferase Mu 3 (GSTM3) Protein (His)

Name: Recombinant Human Glutathione S-Transferase Mu 3 (GSTM3) Protein (His)
Brand: Beta LifeScience
SKU: BLC-07543P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Glutathione S-Transferase Mu 3 (GSTM3) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P21266
Target Symbol	GSTM3
Synonyms	(GST class-mu 3)(GSTM3-3)(hGSTM3-3)
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC
Expression Range	1-225aa
Protein Length	Full Length
Mol. Weight	30.6 kDa
Research Area	Metabolism
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. May govern uptake and detoxification of both endogenous compounds and xenobiotics at the testis and brain blood barriers.
Subcellular Location	Cytoplasm.
Protein Families	GST superfamily, Mu family
Database References	HGNC: 4635 OMIM: 138390 KEGG: hsa:2947 STRING: 9606.ENSP00000256594 UniGene: PMID: 27993795 Expression of GSTM3 might be regulated by epigenetic changes in lens tissue. Hypermethylation in GSTM3 promoter and altered histone modification might have a role in the ARC formation. PMID: 27607418 No associations between the GSTT1, GSTP1, and GSTM3 genotypes and neoplasia risk were observed. In conclusion, we determined the genotype distribution of GST polymorphisms in control subjects and breast cancer patients from northeastern Mexico. PMID: 26125851 NSD1 interacted with RNAPII and bound to GSTM3 -63A/C TATA box. PMID: 25193115 All three markers correlated significantly with regional lymph node metastasis: FXYD3 (p = 0.0110), S100A11 (p = 0.0071), and GSTM3 (p = 0.0173) in colon cancer lymphatic metastasis. PMID: 22430872 This meta-analysis suggests that the GSTM3 A/B polymorphism may be an important protective factor for head and neck cancer, especially of laryngeal cancer and Caucasian populations. PMID: 24416175 rs1332018 genetic variants in the GSTM3 promoter predispose the host to downregulating GSTM3 expression in kidney, facilitate carcinogenesis, and predict an unfavourable postoperative prognosis of renal cell carcinoma. PMID: 24157827 In conclusion, this epistatic interaction showed a high degree of consistency when stratifying by sex, the epsilon4 allele of apolipoprotein E genotype, and geographic region. PMID: 23036584 The GSTM3 A/B gene polymorphism is not associated with lung cancer susceptibility. PMID: 23167362 Methylation of GSTM3 promoter may contribute to oxidative stress-associated liver damage and correlate with the disease severity in Acute-on-chronic hepatitis B liver failure. PMID: 22976281 There were no significant differences in distribution of 3-bp deletion polymorphism in intron 6 variant allele in Glutathione-S-transferase M3 between chronic obstructive pulmonary disease patients and controls in a north Indian population. PMID: 21513434 In individuals from Angola, Mozambique and the Sao Tome e Principe islands, the GSTM3B allele was three times more frequent (0.74-0.78) than the GSTM3A allele (0.22-0.26), with no significant differences in allele frequency across the three groups. PMID: 20549140 Diminished GSTM3 mRNA levels correlated with decreased minichromosome maintenance deficient 3 (MCM3) mRNA levels in a diagnostic and SNP-dependent fashion in Alzheimer disease. PMID: 18423940 The presence of the GSTM3B allele appears to associated with a reduced risk of laryngeal squamous cell carcinoma. PMID: 19922706 No increased prostate scancer risk for men carrying any of the GSTM1 or GSTT1 genotypes. PMID: 14968442 Glutathione S-transferase hGSTM3 has a role in ageing-associated neurodegeneration PMID: 15621212 GSTM3 -63C allele strongly affects gene expression and suggests that individuals who carry the low expression allele may be deficient in glutathione transferase catalyzed biological functions. PMID: 15665284 Single marker association analyses revealed that the AGG/AGG genotype of the GSTM3 rs1799735 (del/AGG) polymorphism was associated with an increased risk of AD (p=0.05), especially in the group of APOE4-allele non-carriers (p=0.004; OR=2.07). PMID: 17904251 distribution of -63A/C polymorphism of human glutathione S-transferase M3(GSTM3) gene in Chinese Han population and the association of -63A/C polymorphism with essential hypertension PMID: 17922434 The GSTM3A/*A genotype was 76% in cancer cases versus 74% in controls; a significant association between smoking status and GSTM3 genotype was not detected. PMID: 18569590 Our results suggested GSTM3 (AB + BB) genotype to be significantly associated with prostate cancer risk. PMID: 18668224 GST-M3 activity is possibly involved in protection against mucosal atrophy caused by H. pylori as the levels of IgG titer and pepsinogen I are linked to mucosal status. PMID: 19696791 The researchers found evidence of an increased risk for non-Hodgkin's lymphoma in women who used hair dye before 1980 and who were carriers of the GSTM3 intron 6 deletion. PMID: 19822571

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.