Recombinant Human Glutathione S-Transferase A4 (GSTA4) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-10140P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Glutathione S-Transferase A4 (GSTA4) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-10140P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Glutathione S-Transferase A4 (GSTA4) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb O15217
Target Symbol GSTA4
Synonyms DKFZp686D21185; Glutathione S alkyltransferase A4; Glutathione S aralkyltransferase A4; Glutathione S aryltransferase A4; Glutathione S transferase A4 4; Glutathione S transferase A4; Glutathione S transferase alpha 4 ; Glutathione S-transferase A4; Glutathione S-transferase A4-4; Glutathione transferase A4 4; GST class alpha member 4; GST class-alpha member 4; GSTA4 4; GSTA4; GSTA4_HUMAN; GTA4; OTTHUMP00000016624; OTTHUMP00000016625; S (hydroxyalkyl)glutathione lyase A4
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His-SUMO
Target Protein Sequence MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
Expression Range 1-222aa
Protein Length Full Length
Mol. Weight 41.7kDa
Research Area Metabolism
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. This isozyme has a high catalytic efficiency with 4-hydroxyalkenals such as 4-hydroxynonenal (4-HNE).
Subcellular Location Cytoplasm.
Protein Families GST superfamily, Alpha family
Database References

HGNC: 4629

OMIM: 605450

KEGG: hsa:2941

STRING: 9606.ENSP00000359998

UniGene: PMID: 27065323

  • Decreased gene expression of GSTA4 is associated with drug resistance in cervical cancer. PMID: 24403508
  • drug resistance in three strains of tumor cells is associated with significant increase in hGSTP1 and hGSTA4 gene expression, whereas increased hGSTK1 gene expression was detected only in resistant erythroleukemia and mammary adenocarcinoma cells. PMID: 23330092
  • GSTA4 down-regulation and the concomitant increase in 4-hydroxynonenal adducts in muscle are indicative of susceptibility to infection in individuals with severe thermal injuries. PMID: 22038048
  • Data show that mandatory overexpression of hGSTA4 by transient transfection in KYSE30 cells and attenuation of HNE-induced EGFR phosphorylation. PMID: 21751261
  • analysis of four novel mutations that change the function of leukotriene C(4) synthase and are associated with increased risk of venous thromboembolism and ischemic stroke PMID: 20456754
  • Gsta4/GSTA4 is a novel susceptibility gene for NMSC that affects risk in both mice and humans. PMID: 20966433
  • Results indicate that downregulation of GSTA4 in adipose tissue leads to increased protein carbonylation, ROS production, and mitochondrial dysfunction and may contribute to the development of insulin resistance and type 2 diabetes. PMID: 20150287
  • GSTA4-4 exploits the hydroxyl group of either 4R- or 4S-hydroxynonenal (HNE), while specifically binding HNE and glutathione (GSH) to maintain high catalytic efficiency linked with stereoselective product formation for both enantiomeric substrates. PMID: 20085333
  • null mice had a significantly lower survival time than wild-type controls when chronically treated with relatively low doses of paraquat, a finding consistent with a role of glutathione transferase A4-4 in the defense against oxidative stress PMID: 14761685
  • We now demonstrate that hGSTA4-transfection also causes a profound change in the expression of genes involved in cell adhesion, cell cycle control, proliferation, cell growth, and apoptosis. PMID: 16005854
  • we observed a single nucleotide polymorphism (SNP) G351A leading to the silent mutation Gln117Gln.No significant difference was observed in the distribution of this GSTA4 polymorphism between Parkinson disease individuals and healthy controls PMID: 16054170
  • The effect of over-expression of GSTA4 mRNA on the sensitivity of HepG2 cells to 4-hydroxynonenal injury is reported. PMID: 17553661
  • These results demonstrate that oxidative stress mediated disruption of tight junctions in endothelial cells may be attenuated by hGSTA4-4 expression. PMID: 18080870
  • GSTA4-4 may play an important defensive role against atherogenesis through detoxification of 4-HNE and upregulation of inducible nitric oxide synthase PMID: 18485437
  • genetic polymorphisms in GSTA4 had modification effects on smoking-related lung cancer risk, particularly among patients with squamous cell carcinoma and small-cell-lung-cancer. PMID: 18767114
  • 4-HNE is involved in p53-mediated signaling in in vitro cell cultures as well as in vivo that can be regulated by glutathione transferase PMID: 18930016
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed