Recombinant Human Glutathione Peroxidase 1 (GPX1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-08130P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Glutathione Peroxidase 1 (GPX1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-08130P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Glutathione Peroxidase 1 (GPX1) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P07203 |
| Target Symbol | GPX1 |
| Synonyms | AL033363; Cellular glutathione peroxidase; Glutathione peroxidase 1; Glutathione peroxidase; GPx 1; GPx-1; GPX1; GPX1_HUMAN; GPXD; GSHPx-1; GSHPX1; MGC14399; MGC88245 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLSGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA |
| Expression Range | 1-203aa(U49S) |
| Protein Length | Full Length |
| Mol. Weight | 38.1kDa |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Protects the hemoglobin in erythrocytes from oxidative breakdown. In platelets, plays a crucial role of glutathione peroxidase in the arachidonic acid metabolism. |
| Subcellular Location | Cytoplasm. |
| Protein Families | Glutathione peroxidase family |
| Database References | HGNC: 4553 OMIM: 138320 KEGG: hsa:2876 STRING: 9606.ENSP00000407375 UniGene: PMID: 29246792 |
