Recombinant Human Glutathione Peroxidase 1 (GPX1) Protein (His)

Beta LifeScience SKU/CAT #: BLC-03964P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Glutathione Peroxidase 1 (GPX1) Protein (His)

Beta LifeScience SKU/CAT #: BLC-03964P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Glutathione Peroxidase 1 (GPX1) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P07203
Target Symbol GPX1
Synonyms AL033363; Cellular glutathione peroxidase; Glutathione peroxidase 1; Glutathione peroxidase; GPx 1; GPx-1; GPX1; GPX1_HUMAN; GPXD; GSHPx-1; GSHPX1; MGC14399; MGC88245
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His
Target Protein Sequence MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLSGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA
Expression Range 1-203aa(U49S)
Protein Length Full Length
Mol. Weight 26.1kDa
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Protects the hemoglobin in erythrocytes from oxidative breakdown. In platelets, plays a crucial role of glutathione peroxidase in the arachidonic acid metabolism.
Subcellular Location Cytoplasm.
Protein Families Glutathione peroxidase family
Database References

HGNC: 4553

OMIM: 138320

KEGG: hsa:2876

STRING: 9606.ENSP00000407375

UniGene: PMID: 29246792

  • there is no correlation between idiopathic male infertility and the GPx1 codon Pro198Leu polymorphism; further studies are needed to investigate other genetic factors that influence the development of idiopathic male infertility PMID: 27028814
  • Increased glutathione peroxidase (GPx) activity seemed to compensate for a decrease in GPx1 protein due to enhanced degradation via the proteasome. Mass spectrometry analysis identified Lys-114 as a possible carbonylation target which provides a vestibule for the substrate H2O2 and thus enhances the enzymatic reaction PMID: 29499564
  • ESR1 and GPX1 expression levels were found to be significantly down-regulated by 14.7% and 7.4% (respectively) in the tumorous breast tissue when compared to the non-malignant one. PMID: 29543921
  • The result of this study suggested that GPX1 Pro198Leu polymorphism could not be a risk factor for breast cancer in Rwanda. PMID: 29411539
  • A significant increase in the T allele and TT genotype frequencies was observed in diabetic peripheral neuropathy patients compared to control diabetics. The association remained significant after correction for age, disease duration, HbA1c and BMI. PMID: 27592002
  • No significant differences in allelic or genotypic frequencies of GPX1 rs1050450 or GSTP1 rs1695 were detected between Chinese schizophrenia cases and controls. PMID: 28872562
  • Genetic variations in selenoprotein genes modulated both GPX1 and SELENOP selenoprotein gene expression and global gene expression in response to Brazil nut supplementation. PMID: 28696394
  • Allele-specific interaction between GPX1 and MnSOD affects the levels of Bcl2, Sirt3 and E-cadherin. PMID: 28587495
  • GPX1, GPX3 and GPX4 may be upregulated in response to a change in oxidative stress during an acute coronary syndromes PMID: 28298473
  • The Pro198Leu polymorphism (rs1050450) to the selenoprotein glutathione peroxidase 1 gene (GPX1), and GSTM1 deletion had no effect on mercury levels in mildly exposed people, suggesting these genetic variants impact mercury levels only in highly exposed populations. PMID: 27450956
  • Evaluation of Glutathione Peroxidase and KCNJ11 Gene Polymorphisms in Patients with New Onset Diabetes Mellitus After Renal Transplantation PMID: 28073131
  • G/C (rs8179169; Arg5Pro) and T/C (rs4991448; Leu6Pro) polymorphisms significantly associated with vitiligo PMID: 26991090
  • Data show that the inflammation of the gallbladder wall (IGW) correlated significantly with plasma GPX1 and hs-CRP (high-sensitivity C-reactive protein) values suggesting that inflammation and oxidative stress are related. PMID: 29187474
  • High GPX1 expression is associated with oral squamous cell carcinoma. PMID: 28653098
  • GPX1 is a gatekeeper restraining the oncogenic power of mitochondrial ROS generated by SOD2 is presented. Review. PMID: 28087256
  • Using lens epithelial cells derived from targeted inactivation of Prdx6(-/-) gene and relative enzymatic and stability assays, we discovered dramatic increases in GSH-peroxidase (30%) and aiPLA2 (37%) activities and stability in the K122/142 R mutant, suggesting Sumo1 destabilized Prdx6 integrity PMID: 28055018
  • Coronary angiography findings indicated that individuals possessing Pro198Leu (CT) polymorphism were found to be associated with low erythrocyte GPX-1 activity and increased susceptibility for coronary artery disease. PMID: 27229152
  • High GPX1 expression is associated with Thyroid Tumors. PMID: 26970173
  • Data suggest that serum myeloperoxidase (GPX1) levels are significantly associated with higher asymmetric dimethyl-arginine (ADMA) levels and up-regulation of circulating components of renin-angiotensin-aldosterone-system in patients with cardiovascular disease (CVD). Serum levels of ADMA and angiotensin II are more predictive for all-cause and CVD mortality compared to GPX1. PMID: 28322753
  • Pro198Leu of GPX1 might be a genetic risk factor in the development of Nephrolithiasis in South Iranian patients with lower Glutathione Peroxidase enzyme activity. PMID: 28174350
  • our data suggest that gene polymorphisms of GPX1 Pro198Leu and CAT C262T may have a protective role in the development of primary open-angle glaucoma in a Polish population. PMID: 28547970
  • GPx-1 expression deters the unfolded protein response following exposure to cigarette smoke PMID: 28070146
  • Knockdown of GPX1 in hucMSCs abrogated antioxidant and anti-apoptotic abilities of hucMSC-Ex and diminished the hepatoprotective effects of hucMSC-Ex in vitro and in vivo. Thus, hucMSC-Ex promote the recovery of hepatic oxidant injury through the delivery of GPX1. PMID: 28089078
  • The potential protective effect without statistical relationships were also observed for other genotypes and alleles studied polymorphic variants of antioxidant enzymes in CD and CAT- 262C / T and + 35 A / C SOD1 in UC. Conducted our audit should be extended to more group of patients in order to assess whether or not to confirm the observed during analysis, the protective effect of CAT-262 C / T in ulcerative colitis and PMID: 28141554
  • No significant differences in SOD and GPx activity both in plasma and saliva were found between Crohn's Disease remission group and the control group. PMID: 28011951
  • GPX1 and SEPP1 Single Nucleotide Polymorphism were not associated with any changes in the expression of related genes. GPX1 was shown to modulate the expression of unrelated target, SEP15, upon Se supplementation, both alone and in combination with SEPP1. PMID: 26658762
  • Study demonstrates that SOD2 rs4880, GPX1 rs1050450 and CAT rs1001179 are not associated with an increased susceptibility to epilepsy after neonatal hypoxic-ischemic encephalopathyor its drug resistance PMID: 28222320
  • Data show that antioxidant enzymes SOD2 and GPX1 expression and GPX1 and SOD1 activity were significantly higher in patients at diagnosis of bladder cancer (BC) in comparison to controls. PMID: 28179340
  • Data show that the placement of rectus sheath block (RSB) analgesia did not significantly affect the level of oxidative stress biomarker plasma glutathione peroxidase (GPX1) level in patients with benign disease or cancer. PMID: 28179349
  • Adiponectin gene promoter -11377C/G (CG), -11377C/G (GG), GPx-1 gene C594T (CT), C594T (TT), and cigarette smoking are risk factors in nonalcoholic fatty liver disease (NAFLD). PMID: 26897098
  • Our results suggest that GSTP1 rs1695 and GPX1 rs1050450 single nucleotide polymorphisms have no effect on the risk of preeclampsia in the Chinese Han population. PMID: 27825163
  • Results show no significant association between glutathione peroxidase 1 (GPX1) Pro198Leu polymorphism and risk of bladder cancer. PMID: 28145855
  • It was concluded that the genotype for SNPs in GPX1 and gender affected biomarkers of Se status in this pilot study with healthy Brazilians. PMID: 27164132
  • The effects of oleuropein (OL) on hydrogen peroxide-induced oxidative stress in L02 cells showed that SOD1, GPx1, and catalase levels were all increased, and suggested that OL is a potent antioxidant and may be therapeutically useful in liver disease prevention. PMID: 27914828
  • This meta-analysis showed a significant association between low GPx level and vitiligo. PMID: 27218102
  • GPx-1 Pro200Leu polymorphism was associated with obesity especially with morbid obesity, but not with obese participants with prediabetes or diabetes PMID: 26545512
  • variants of GPx1 and MnSOD should not be considered as a risk factor of laryngeal squamous cell carcinoma. PMID: 27188866
  • Glucose oscillations may exert more deleterious effects on the endothelium than high glucose, likely due to an impaired response of glutathione peroxidase-1, coupled by the upregulation of miR-185 PMID: 27137793
  • Results showed no statistically significant difference between the vitiligo and MnSOD Ala-9Val and GPx1 Pro198Leu gene polymorphisms in Turkish population. PMID: 27100222
  • The purpose of the study was to evaluate the plasma level of superoxide dismutase (SOD), catalase (CAT), and glutathione peroxidase (GPX) and the association between polymorphic variants in genes encoding for GPx1, SOD, CAT and the risk of distal symmetric polyneuropathy in type 2 diabetes mellitus patients. PMID: 26674569
  • This study examined the relationship between levels of GPx activity, reactive oxygen species, and platelet activation in 51 acute coronary syndrome (ACS) patients. PMID: 27993878
  • The MnSOD, GPX1 and CAT genotypes and allele frequencies of acute kidney injury patients did not differ significantly from those of healthy controls. PMID: 26787049
  • the presence of variant allele and genotype of GPX1 Pro198Leu and GSTP1 Ile105Val gene polymorphisms may modulate the risk of developing acute myeloid leukemia PMID: 26823947
  • GPX1 Pro198Leu rs1050450 genotypes differentially affect the selenium status and GPx activity. PMID: 26661784
  • patients with end-stage renal disease (ESRD) and those without chronic kidney disease (CKD) of Han Chinese origin, with SOD2 (Val16Ala), GPX1 (Pro197Leu), and PPAR-gamma (Pro12Ala, C161T) were genotyped. PMID: 26881045
  • 1,25D3 works as a modifier of NF-kappaB/GPX1/uPA expression, inhibiting cisplatin-resistance and cell invasive ability of salivary adenoid cystic carcinoma cells PMID: 26782341
  • SOD2 but not GPx1 activity decreased significantly in the presence of the mutated allele (Val and Leu, respectively). PMID: 27067415
  • GPX1*Pro198Leu AND GPX3 rs2070593 as genetic risk markers for Italian asthmatic patients PMID: 26662676
  • An increase in both SOD1 and GPx1 activity is involved in the protective effect of sulodexide on ischemic endothelial cells. PMID: 26477504
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed